Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human Jagged-1/JAG1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

Jagged-1/JAG1 Recombinant Protein | JAG1 recombinant protein

Recombinant Human Jagged-1/JAG1 Protein

Gene Names
JAG1; AGS; AHD; AWS; HJ1; AGS1; DCHE; CD339; JAGL1
Purity
>95% by SDS-PAGE.
Synonyms
Jagged-1/JAG1; Recombinant Human Jagged-1/JAG1 Protein; Protein jagged-1 I; Jagged-1; JAGL1; HJ1; JAG1 and CD339; JAG1 recombinant protein
Ordering
For Research Use Only!
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Sequence
QFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNW
Sequence Length
1218
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human Jagged-1/JAG1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Human Jagged-1/JAG1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for JAG1 recombinant protein
Recombinant Human Jagged-1/JAG1 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Gln34-Ser1046) of human Jagged-1/JAG1 (Accession #P78504) fused with an Fc tag at the C-terminus.
Product Categories/Family for JAG1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
182
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
protein jagged-1
NCBI Official Synonym Full Names
jagged canonical Notch ligand 1
NCBI Official Symbol
JAG1
NCBI Official Synonym Symbols
AGS; AHD; AWS; HJ1; AGS1; DCHE; CD339; JAGL1
NCBI Protein Information
protein jagged-1
UniProt Protein Name
Protein jagged-1
Protein Family
UniProt Gene Name
JAG1
UniProt Synonym Gene Names
JAGL1; Jagged1; hJ1
UniProt Entry Name
JAG1_HUMAN

NCBI Description

The jagged 1 protein encoded by JAG1 is the human homolog of the Drosophilia jagged protein. Human jagged 1 is the ligand for the receptor notch 1, the latter is involved in signaling processes. Mutations that alter the jagged 1 protein cause Alagille syndrome. Jagged 1 signalling through notch 1 has also been shown to play a role in hematopoiesis. [provided by RefSeq, Nov 2019]

Uniprot Description

JAG1: Ligand for multiple Notch receptors and involved in the mediation of Notch signaling. May be involved in cell-fate decisions during hematopoiesis. Seems to be involved in early and late stages of mammalian cardiovascular development. Inhibits myoblast differentiation. Enhances fibroblast growth factor-induced angiogenesis (in vitro). Interacts with NOTCH2 and NOTCH3. Interacts with NOTCH1 (in the presence of calcium ions). Widely expressed in adult and fetal tissues. In cervix epithelium expressed in undifferentiated subcolumnar reserve cells and squamous metaplasia. Expression is up-regulated in cervical squamous cell carcinoma. Expressed in bone marrow cell line HS-27a which supports the long-term maintenance of immature progenitor cells.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 20p12.1-p11.23

Cellular Component: membrane; apical part of cell; integral to plasma membrane; extracellular region; plasma membrane

Molecular Function: protein binding; growth factor activity; calcium ion binding; structural molecule activity; Notch binding

Biological Process: endothelial cell differentiation; nervous system development; Notch signaling pathway; positive regulation of myeloid cell differentiation; T cell mediated immunity; Notch receptor processing; auditory receptor cell differentiation; cell fate determination; negative regulation of fat cell differentiation; regulation of cell migration; regulation of cell proliferation; keratinocyte differentiation; myoblast differentiation; positive regulation of osteoblast differentiation; negative regulation of neuron differentiation; response to muramyl dipeptide; morphogenesis of an epithelial sheet; positive regulation of transcription from RNA polymerase II promoter; hemopoiesis; blood vessel remodeling; angiogenesis; positive regulation of Notch signaling pathway

Disease: Tetralogy Of Fallot; Alagille Syndrome 1

Research Articles on JAG1

Similar Products

Product Notes

The JAG1 jag1 (Catalog #AAA9140302) is a Recombinant Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QFELEILSMQ NVNGELQNGN CCGGARNPGD RKCTRDECDT YFKVCLKEYQ SRVTAGGPCS FGSGSTPVIG GNTFNLKASR GNDRNRIVLP FSFAWPRSYT LLVEAWDSSN DTVQPDSIIE KASHSGMINP SRQWQTLKQN TGVAHFEYQI RVTCDDYYYG FGCNKFCRPR DDFFGHYACD QNGNKTCMEG WMGPECNRAI CRQGCSPKHG SCKLPGDCRC QYGWQGLYCD KCIPHPGCVH GICNEPWQCL CETNW. It is sometimes possible for the material contained within the vial of "Jagged-1/JAG1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.