Inosine-uridine-preferring nucleoside hydrolase homolog (iunH) Recombinant Protein | iunH recombinant protein
Recombinant Dictyostelium discoideum Inosine-uridine-preferring nucleoside hydrolase homolog (iunH)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Inosine-uridine-preferring nucleoside hydrolase homolog (iunH); Recombinant Dictyostelium discoideum Inosine-uridine-preferring nucleoside hydrolase homolog (iunH); iunH recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-340, Full length protein
Sequence
MLNEELLPIWLDHDCGHDDAFAMLLAFHSKIFNILGISSVHGNQTVDKTTINALITLEIIGKSNCGYEVVKGVRSPMCRPEQVCSEIHGETGLDCPTAELPKPTQLPITDRPAIQVMFEKISKFYTDNQQKQKVIIVATGSLTNVALLFAVYPQIKPMVEVSLLGGSINFGNISPAAEYNILVDPEAAKVVFESGVKVIMVPLECSHKALVNEKILERISDIEKADGKQTQFIKIIKGLLLFFADNYKSTFDFDHPPLHDPLAVAYLIDPTIFKCKLMRVDIETSSHLCLGRTVVDLFSMSKLQKNVHVCTDINVDKFWDLMINAIDNCYNHLYKSNILK
Sequence Length
340
Species
Dictyostelium discoideum (Slime mold)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37,993 Da
NCBI Official Full Name
N-D-ribosylpurine ribohydrolase
NCBI Official Symbol
iunH
NCBI Protein Information
N-D-ribosylpurine ribohydrolase; inosine-uridine nucleoside N-ribohydrolase
UniProt Protein Name
Inosine-uridine-preferring nucleoside hydrolase homolog
Protein Family
UniProt Gene Name
iunH
UniProt Synonym Gene Names
IU-NH; IU-nucleoside hydrolase
Uniprot Description
Catalyzes the hydrolysis of all of the commonly occurring purine and pyrimidine nucleosides into ribose and the associated base.
Similar Products
Product Notes
The iunH iunh (Catalog #AAA1366807) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-340, Full length protein. The amino acid sequence is listed below: MLNEELLPIW LDHDCGHDDA FAMLLAFHSK IFNILGISSV HGNQTVDKTT INALITLEII GKSNCGYEVV KGVRSPMCRP EQVCSEIHGE TGLDCPTAEL PKPTQLPITD RPAIQVMFEK ISKFYTDNQQ KQKVIIVATG SLTNVALLFA VYPQIKPMVE VSLLGGSINF GNISPAAEYN ILVDPEAAKV VFESGVKVIM VPLECSHKAL VNEKILERIS DIEKADGKQT QFIKIIKGLL LFFADNYKST FDFDHPPLHD PLAVAYLIDP TIFKCKLMRV DIETSSHLCL GRTVVDLFSM SKLQKNVHVC TDINVDKFWD LMINAIDNCY NHLYKSNILK. It is sometimes possible for the material contained within the vial of "Inosine-uridine-preferring nucleoside hydrolase homolog (iunH), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
