Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4) Recombinant Protein | ITIH4 recombinant protein

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), partial

Cat. Num. AAA1307065

• Gene Names: ITIH4; H4P; IHRP; GP120; PK120; ITIHL1; PK-120; ITI-HC4
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4); Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4); partial; Inter-alpha-trypsin inhibitor family heavy chain-related protein; IHRP; Plasma kallikrein sensitive glycoprotein 120; Gp120; PK-120; ITIH4 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 689-930. Partial, 35 kDa inter-alpha-trypsin inhibitor heavy chain H4
• Sequence: RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL

• Production Note: Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for ITIH4 recombinant protein

Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.

Product Categories/Family for ITIH4 recombinant protein

Immunology

References

cDNA and deduced amino acid sequence of human PK-120, a plasma kallikrein-sensitive glycoprotein.Nishimura H., Kakizaki I., Muta T., Sasaki N., Pu P.X., Yamashita T., Nagasawa S.FEBS Lett. 357:207-211(1995) Cloning and characterization of cDNA for inter-alpha-trypsin inhibitor family heavy chain-related protein (IHRP), a novel human plasma glycoprotein.Saguchi K., Tobe T., Hashimoto K., Sano Y., Nakano Y., Miura N.-H., Tomita M.J. Biochem. 117:14-18(1995) Isolation and characterization of the human inter-alpha-trypsin inhibitor family heavy chain-related protein (IHRP) gene (ITIHL1).Saguchi K., Tobe T., Hashimoto K., Nagasaki Y., Oda E., Nakano Y., Miura N.H., Tomita M.J. Biochem. 119:898-905(1996) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) BIP co-chaperone MTJ1/ERDJ1 interacts with inter-alpha-trypsin inhibitor heavy chain 4.Kroczynska B., King-Simmons L., Alloza L., Alava M.A., Elguindi E.C., Blond S.Y.Biochem. Biophys. Res. Commun. 338:1467-1477(2005) The DNA sequence, annotation and analysis of human chromosome 3.Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.Nature 440:1194-1198(2006) Functional prediction of the coding sequences of 79 new genes deduced by analysis of cDNA clones from human fetal liver.Zhang C., Yu Y., Zhang S., Wei H., Zhang Y., Zhou G., Bi J., Liu M., He F. Purification and characterization of a novel glycoprotein which has significant homology to heavy chains of inter-alpha-trypsin inhibitor family from human plasma.Choi-Miura N.-H., Sano Y., Oda E., Nakano Y., Tobe T., Yanagishita T., Taniyama M., Katagiri T., Tomita M.J. Biochem. 117:400-407(1995) Purification and characterization of a novel substrate for plasma kallikrein (PK-120) in human plasma.Pu X.P., Iwamoto A., Nishimura H., Nagasawa S.Biochim. Biophys. Acta 1208:338-343(1994) ITIH4 serum concentration increases during acute-phase processes in human patients and is up-regulated by interleukin-6 in hepatocarcinoma HepG2 cells.Pineiro M., Alava M.A., Gonzalez-Ramon N., Osada J., Lasierra P., Larrad L., Pineiro A., Lampreave F.Biochem. Biophys. Res. Commun. 263:224-229(1999) Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.Zhang H., Li X.-J., Martin D.B., Aebersold R.Nat. Biotechnol. 21:660-666(2003) Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.Bunkenborg J., Pilch B.J., Podtelejnikov A.V., Wisniewski J.R.Proteomics 4:454-465(2004) Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.J. Proteome Res. 4:2070-2080(2005) Inter-alpha-trypsin inhibitor heavy chain 4 is a novel marker of acute ischemic stroke.Kashyap R.S., Nayak A.R., Deshpande P.S., Kabra D., Purohit H.J., Taori G.M., Daginawala H.F.Clin. Chim. Acta 402:160-163(2009) Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) The absolute quantification of eight inter-alpha-trypsin inhibitor heavy chain 4 (ITIH4)-derived peptides in serum from breast cancer patients.van den Broek I., Sparidans R.W., van Winden A.W., Gast M.C., van Dulken E.J., Schellens J.H., Beijnen J.H.Proteomics Clin. Appl. 4:931-939(2010) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) Human urinary glycoproteomics; attachment site specific analysis of N-and O-linked glycosylations by CID and ECD.Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G.Mol. Cell. Proteomics 0:0-0(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4.Chandler K.B., Brnakova Z., Sanda M., Wang S., Stalnaker S.H., Bridger R., Zhao P., Wells L., Edwards N.J., Goldman R.J. Proteome Res. 13:3314-3329(2014) SNP analysis of the inter-alpha-trypsin inhibitor family heavy chain-related protein (IHRP) gene by a fluorescence-adapted SSCP method.Tozaki T., Choi-Miura N.-H., Taniyama M., Kurosawa M., Tomita M.BMC Med. Genet. 3:6-6(2002)

NCBI and Uniprot Product Information

• NCBI GI #: 262050538
• NCBI GeneID: 3700
• NCBI Accession #: NP_001159921.1
• NCBI GenBank Nucleotide #: NM_001166449.1
• UniProt Accession #: Q14624; Q15135; Q9P190; Q9UQ54; B7Z545; E9PGN5
• Molecular Weight: 28.9 kDa
• NCBI Official Full Name: inter-alpha-trypsin inhibitor heavy chain H4 isoform 2
• NCBI Official Synonym Full Names: inter-alpha-trypsin inhibitor heavy chain family member 4
• NCBI Official Symbol: ITIH4
• NCBI Official Synonym Symbols: H4P; IHRP; GP120; PK120; ITIHL1; PK-120; ITI-HC4
• NCBI Protein Information: inter-alpha-trypsin inhibitor heavy chain H4
• UniProt Protein Name: Inter-alpha-trypsin inhibitor heavy chain H4
• Protein Family: Inter alpha-trypsin inhibitor
• UniProt Gene Name: ITIH4
• UniProt Synonym Gene Names: IHRP; ITIHL1; PK120; ITI heavy chain H4; ITI-HC4; Inter-alpha-inhibitor heavy chain 4; IHRP; Gp120; PK-120
• UniProt Entry Name: ITIH4_HUMAN

NCBI Description

The protein encoded by this gene is secreted into the blood, where it is cleaved by plasma kallikrein into two smaller forms. Expression of this gene has been detected only in liver, and it seems to be upregulated during surgical trauma. This gene is part of a cluster of similar genes on chromosome 3. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]

Uniprot Description

ITIH4: May be involved in acute phase reactions. Belongs to the ITIH family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 3p21.1

Cellular Component: cytoplasm; extracellular region; plasma membrane

Molecular Function: endopeptidase inhibitor activity; protein binding; serine-type endopeptidase inhibitor activity

Biological Process: acute-phase response; hyaluronan metabolic process; response to cytokine stimulus

Disease: Hypercholesterolemia, Familial