Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3) Recombinant Protein | ITIH3 recombinant protein
Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3), partial
Gene Names
ITIH3; H3P; SHAP; ITI-HC3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3); Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3); partial; Inter-alpha-trypsin inhibitor heavy chain H3(ITI heavy chain H3)(ITI-HC3)(Inter-alpha-inhibitor heavy chain 3)(Serum-derived hyaluronan-associated protein)(SHAP); ITIH3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
512-651aa, Partial
Sequence
MNSFKADVKGHGATNDLTFTEEVDMKEMEKALQERDYIFGNYIERLWAYLTIEQLLEKRKNAHGEEKENLTARALDLSLKYHFVTPLTSMVVTKPEDNEDERAIADKPGEDAEATPVSPAMSYLTSYQPPQNPYYYVDGD
Species
Homo sapiens (Human)
Relevance
May act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regulate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Product Categories/Family for ITIH3 recombinant protein
References
"Inhibition of tumor growth and metastatic spreading by overexpression of inter-alpha-trypsin inhibitor family chains."Paris S., Sesboue R., Delpech B., Chauzy C., Thiberville L., Martin J.P., Frebourg T., Diarra-Mehrpour M.Int J Cancer 97:615-620(2002)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
99,328 Da
NCBI Official Full Name
inter-alpha-trypsin inhibitor heavy chain H3 preproprotein
NCBI Official Synonym Full Names
inter-alpha-trypsin inhibitor heavy chain 3
NCBI Official Symbol
ITIH3
NCBI Official Synonym Symbols
H3P; SHAP; ITI-HC3
NCBI Protein Information
inter-alpha-trypsin inhibitor heavy chain H3
UniProt Protein Name
Inter-alpha-trypsin inhibitor heavy chain H3
Protein Family
UniProt Gene Name
ITIH3
UniProt Synonym Gene Names
ITI heavy chain H3; ITI-HC3; Inter-alpha-inhibitor heavy chain 3; SHAP
NCBI Description
This gene encodes the heavy chain subunit of the pre-alpha-trypsin inhibitor complex. This complex may stabilize the extracellular matrix through its ability to bind hyaluronic acid. Polymorphisms of this gene may be associated with increased risk for schizophrenia and major depressive disorder. This gene is present in an inter-alpha-trypsin inhibitor family gene cluster on chromosome 3. [provided by RefSeq, Jul 2015]
Uniprot Description
May act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regulate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes.
Research Articles on ITIH3
Similar Products
Product Notes
The ITIH3 itih3 (Catalog #AAA9018538) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 512-651aa, Partial. The amino acid sequence is listed below: MNSFKADVKG HGATNDLTFT EEVDMKEMEK ALQERDYIFG NYIERLWAYL TIEQLLEKRK NAHGEEKENL TARALDLSLK YHFVTPLTSM VVTKPEDNED ERAIADKPGE DAEATPVSPA MSYLTSYQPP QNPYYYVDGD. It is sometimes possible for the material contained within the vial of "Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
