Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Integrin beta-6 Recombinant Protein | ITGB6 recombinant protein

Integrin beta-6

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Integrin beta-6; ITGB6 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-577aa; full length protein
Sequence
SASMDDDLNTIKELGSLLSKEMSKLTSNFRLGFGSFVEKPVSPFMKTTPEEIANPCSSIP YICLPTFGFKHILPLTNDAERFNEIVKKQKISANIDNPEGGFDAIMQAAVCKEKIGWRND SLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNEYSMSTVMEYPTIGQLIDKVVQ NNVLLIFAVTQEQVPLYENYAKLIPGATVGLLHKDSGNILQLIISAYEELRSEVELEVLG DTEGLNLSFSAVCNNGTLFPHQKKCLHMKVGETASFNVTVSIPNCERKSRHVIIKPVGLG DTLEILVSPECSCDCQKEVEVNSSKCHNGNGSYQCGVCACNPGHMGPHCECGEDTLSTDS CKETPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCDNFSCVRHKGLLCGDNGDCECG ECVCRSGWTGEYCNCTTSTDTCISEDGTLCSGRGDCVCGKCVCTNPGASGPTCERCPTCS DPCNSKRSCIECHLSADGQPGEECVDKCKLAGVTISKEADFSKDSSVSCSLQGENECLIT FLISTDNEGKTIIHNISEKDCPKPPNIPMIMLGVSLA
Sequence Length
Full Length Protein
Species
Cavia porcellus (Guinea pig)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for ITGB6 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for ITGB6 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
62,299 Da
NCBI Official Full Name
Integrin beta-6
UniProt Protein Name
Integrin beta-6
Protein Family
UniProt Gene Name
ITGB6
UniProt Entry Name
ITB6_CAVPO

Uniprot Description

Integrin alpha-V/beta-6 is a receptor for fibronectin and cytotactin. It recognizes the sequence R-G-D in its ligands. ITGAV:ITGB6 acts as a receptor for fibrillin-1 (FBN1) and mediates R-G-D-dependent cell adhesion to FBN1.

Similar Products

Product Notes

The ITGB6 itgb6 (Catalog #AAA7042960) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-577aa; full length protein. The amino acid sequence is listed below: SASMDDDLNT IKELGSLLSK EMSKLTSNFR LGFGSFVEKP VSPFMKTTPE EIANPCSSIP YICLPTFGFK HILPLTNDAE RFNEIVKKQK ISANIDNPEG GFDAIMQAAV CKEKIGWRND SLHLLVFVSD ADSHFGMDSK LAGIVIPNDG LCHLDSKNEY SMSTVMEYPT IGQLIDKVVQ NNVLLIFAVT QEQVPLYENY AKLIPGATVG LLHKDSGNIL QLIISAYEEL RSEVELEVLG DTEGLNLSFS AVCNNGTLFP HQKKCLHMKV GETASFNVTV SIPNCERKSR HVIIKPVGLG DTLEILVSPE CSCDCQKEVE VNSSKCHNGN GSYQCGVCAC NPGHMGPHCE CGEDTLSTDS CKETPDHPSC SGRGDCYCGQ CICHLSPYGN IYGPYCQCDN FSCVRHKGLL CGDNGDCECG ECVCRSGWTG EYCNCTTSTD TCISEDGTLC SGRGDCVCGK CVCTNPGASG PTCERCPTCS DPCNSKRSCI ECHLSADGQP GEECVDKCKL AGVTISKEAD FSKDSSVSCS LQGENECLIT FLISTDNEGK TIIHNISEKD CPKPPNIPMI MLGVSLA. It is sometimes possible for the material contained within the vial of "Integrin beta-6, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.