Integrin beta-4 (Itgb4) Recombinant Protein | Itgb4 recombinant protein

Recombinant Rat Integrin beta-4 (Itgb4), Partial

Cat. Num. AAA7115367

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Integrin beta-4 (Itgb4); Recombinant Rat Integrin beta-4 (Itgb4); Partial; GP150; CD_antigen: CD104; Itgb4 recombinant protein

• Host: In Vitro E Coli Expression System
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Tris-Based Buffer, 50% Glycerol
• Sequence Positions: 28-713aa; Extracellular Domain
• Sequence: SLTENVEEFWDKLQGERISGNLDAPEGGFDAILQTAVCTRDIGWRADSTHLLVFSTESAFHYEADGANVLAGIMNRNDEKCHLDATGAYTQYKTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHKYFPVSSLGVLQEDSSNIVELLEEAFYRIRSNLDIRALDSPRGLRTEVTSDTLQKTETGSFHIKRGEVGTYNVHLRAVEDIDGTHVCQLAKEDQRGNIHLKPSFSDGLRMDASVICDMCACELQKEVQSARCHYRGDFMCGHCVCNEGWSGKTCNCSTGSLSDTQPCLREGEDKPCSGHGECQCGRCVCYGEGRYEGHFCEYDNFQCPRTSGFLCNDRGRCSMGECVCEPGWTGRSCDCPLSNATCIDSNGGICNGLGFCECGRCHCNQRSSLYTDTTCEINYSAIRLGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVDELKKAEEVVEYCSFRDEDDDCTYSYTVEGDGSPGPNSTVLVHKKKDCLPAPS
• Sequence Length: 1807

• Species: Rat
• Tag: N-terminal 6xHis-tagged
• Subcellular Location: Cell Membrane, Single-Pass Type I Membrane Protein, Cell Membrane, Lipid-Anchor, Cell Junction, Hemidesmosome
• Protein Families: Integrin beta chain family
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for Itgb4 recombinant protein

Integrin alpha-6/beta-4 is a receptor for laminin. It plays a critical structural role in the hemidesmosome of epithelial cells. Is required for the regulation of keratinocyte polarity and motility.

Product Categories/Family for Itgb4 recombinant protein

Signal Transduction

References

"Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues." Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C., Olsen J.V. Nat. Commun. 3:876-876(2012).

NCBI and Uniprot Product Information

• NCBI GI #: 6981108
• NCBI GeneID: 25724
• NCBI Accession #: NP_037312.1
• NCBI GenBank Nucleotide #: NM_013180.1
• UniProt Accession #: Q64632
• Molecular Weight: 80.7 kDa
• NCBI Official Full Name: integrin beta-4
• NCBI Official Synonym Full Names: integrin subunit beta 4
• NCBI Official Symbol: Itgb4
• NCBI Protein Information: integrin beta-4
• UniProt Protein Name: Integrin beta-4
• Protein Family: Integrin
• UniProt Gene Name: Itgb4
• UniProt Entry Name: ITB4_RAT

NCBI Description

beta subunit of integrin alpha6/beta4 which is a cell surface receptor for laminin; involved in hemidesmosome formation [RGD, Feb 2006]

Uniprot Description

ITGB4: integrin alpha-6/beta-4 is a receptor for laminin. It plays a critical structural role in the hemidesmosome of epithelial cells. Five alternatively spliced isoforms have been described.

Protein type: Cell adhesion; Membrane protein, integral; Receptor, misc.; Motility/polarity/chemotaxis

Cellular Component: extracellular space; cell surface; membrane; hemidesmosome; leading edge; cytoplasm; plasma membrane; integral to membrane; basal plasma membrane; basement membrane; cell cortex; integrin complex; receptor complex

Molecular Function: G-protein-coupled receptor binding; cell adhesion molecule binding; receptor activity

Biological Process: skin development; integrin-mediated signaling pathway; hemidesmosome assembly; filopodium formation; gut development; cell-matrix adhesion; multicellular organismal development; response to wounding; cell motility involved in cell locomotion; autophagy; mesodermal cell differentiation; cell adhesion