Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Integrin beta-2 Recombinant Protein | ITGB2 recombinant protein

Integrin beta-2

Gene Names
ITGB2; CD18
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Integrin beta-2; ITGB2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-769aa; full length protein
Sequence
QECAKYKVSTCRDCIESGPGCAWCQKLNFSGQGEPDSVRCDTREQLLAKGCVADDIVDPRSLAETQEDQAGGQKQLSPQKVTLYLRPGQAATFNVTFRRAKGYPIDLYYLMDLSYSMLDDLINVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPEKLRNPCPNKEKECQAPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKSSNEFDYPSVGQLAHKLAESNIQPIFAVTKKMVKTYEKLTDIIPKSAVGELSEDSSNVLELIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVSQVNQPRGDCDGVQINVPITFQVKVTASECIQEQSFVIRALGFTDTVTVRVLPQCECRCGDSSKERTLCGNKGSMECGVCRCDAGYIGKHCECQTQGRSSQELEGSCRKDNSSIICSGLGDCICGQCVCHTSDVPNKKIYGQFCECDNMNCERFDGQVCGGEKRGLCFCSTCRCQEGFEGSACQCLKSTQGCLNLQGVECSGRGRCRCNVCQCDFGYQPPLCTDCPSCQVPCARYAKCAECLKFDTGPFAKNCSAECGTTKLLPSRMSGRKCNERDSEGCWMTYFLVQRDGRDNYDLHVEETRECVKGPNIAAIVGGTVGGVVLVGIFLLVIWKVLTHLSDLREYKRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAER
Sequence Length
Full Length Protein
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for ITGB2 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for ITGB2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84,790 Da
NCBI Official Full Name
integrin beta-2
NCBI Official Symbol
ITGB2
NCBI Official Synonym Symbols
CD18
NCBI Protein Information
integrin beta-2
UniProt Protein Name
Integrin beta-2
Protein Family
UniProt Gene Name
ITGB2
UniProt Synonym Gene Names
CD18
UniProt Entry Name
ITB2_PIG

Uniprot Description

Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrins alpha-M/beta-2 and alpha-X/beta-2 are receptors for the iC3b fragment of the third complement component and for fibrinogen. Integrin alpha-X/beta-2 recognizes the sequence G-P-R in fibrinogen alpha-chain. Integrin alpha-M/beta-2 recognizes P1 and P2 peptides of fibrinogen gamma chain. Integrin alpha-M/beta-2 is also a receptor for factor X. Integrin alpha-D/beta-2 is a receptor for ICAM3 and VCAM1. Contributes to natural killer cell cytotoxicity. Involved in leukocyte adhesion and transmigration of leukocytes including T-cells and neutrophils. Triggers neutrophil transmigration during lung injury through PTK2B/PYK2-mediated activation. Integrin alpha-L/beta-2 in association with ICAM3, contributes to apoptotic neutrophil phagocytosis by macrophages.

Research Articles on ITGB2

Similar Products

Product Notes

The ITGB2 itgb2 (Catalog #AAA7042954) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-769aa; full length protein. The amino acid sequence is listed below: QECAKYKVST CRDCIESGPG CAWCQKLNFS GQGEPDSVRC DTREQLLAKG CVADDIVDPR SLAETQEDQA GGQKQLSPQK VTLYLRPGQA ATFNVTFRRA KGYPIDLYYL MDLSYSMLDD LINVKKLGGD LLRALNEITE SGRIGFGSFV DKTVLPFVNT HPEKLRNPCP NKEKECQAPF AFRHVLKLTD NSNQFQTEVG KQLISGNLDA PEGGLDAMMQ VAACPEEIGW RNVTRLLVFA TDDGFHFAGD GKLGAILTPN DGRCHLEDNL YKSSNEFDYP SVGQLAHKLA ESNIQPIFAV TKKMVKTYEK LTDIIPKSAV GELSEDSSNV LELIKNAYNK LSSRVFLDHN ALPDTLKVTY DSFCSNGVSQ VNQPRGDCDG VQINVPITFQ VKVTASECIQ EQSFVIRALG FTDTVTVRVL PQCECRCGDS SKERTLCGNK GSMECGVCRC DAGYIGKHCE CQTQGRSSQE LEGSCRKDNS SIICSGLGDC ICGQCVCHTS DVPNKKIYGQ FCECDNMNCE RFDGQVCGGE KRGLCFCSTC RCQEGFEGSA CQCLKSTQGC LNLQGVECSG RGRCRCNVCQ CDFGYQPPLC TDCPSCQVPC ARYAKCAECL KFDTGPFAKN CSAECGTTKL LPSRMSGRKC NERDSEGCWM TYFLVQRDGR DNYDLHVEET RECVKGPNIA AIVGGTVGGV VLVGIFLLVI WKVLTHLSDL REYKRFEKEK LKSQWNNDNP LFKSATTTVM NPKFAER. It is sometimes possible for the material contained within the vial of "Integrin beta-2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.