Integrin beta-1-binding protein 2 (ITGB1BP2) Recombinant Protein | ITGB1BP2 recombinant protein

Recombinant Human Integrin beta-1-binding protein 2 (ITGB1BP2)

Cat. Num. AAA1391273

• Gene Names: ITGB1BP2; CHORDC3; ITGB1BP; MELUSIN; MSTP015
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Integrin beta-1-binding protein 2 (ITGB1BP2); Recombinant Human Integrin beta-1-binding protein 2 (ITGB1BP2); ITGB1BP2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-347, Full length protein
• Sequence: MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDFSEFLNIKGCTMGPHCAEKLPEAPQPEGPATSSSLQEQKPLNVIPKSAETLRRERPKSELPLKLLPLNISQALEMALEQKELDQEPGAGLDSLIRTGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGAFLAQPGCRVGRHDWGKQLPASCRHDWHQTDSLVVVTVYGQIPLPAFNWVKASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSSVFLMPSRVEISLVKADPGSWAQLEHPDALAKKARAGVVLEMDEEESDDSDDDLSWTEEEEEEEAMGE
• Sequence Length: 347

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 6912438
• NCBI GeneID: 26548
• NCBI Accession #: NP_036410.1
• NCBI GenBank Nucleotide #: NM_012278.3
• UniProt Accession #: Q9UKP3; Q32N04; Q549J7
• Molecular Weight: 36,374 Da
• NCBI Official Full Name: integrin beta-1-binding protein 2 isoform 1
• NCBI Official Synonym Full Names: integrin subunit beta 1 binding protein 2
• NCBI Official Symbol: ITGB1BP2
• NCBI Official Synonym Symbols: CHORDC3; ITGB1BP; MELUSIN; MSTP015
• NCBI Protein Information: integrin beta-1-binding protein 2
• UniProt Protein Name: Integrin beta-1-binding protein 2
• Protein Family: Integrin beta-1-binding protein
• UniProt Gene Name: ITGB1BP2

NCBI Description

This gene encodes a protein with two cysteine and histidine-rich (CHORD) domains, PXXP motifs, YXXI/P motifs, putative SH2 and SH3 domain binding motifs, and an acidic region at the C-terminus that can bind calcium. Two hybrid analysis showed that this protein interacts with the cytoplasmic domain of the beta 1 integrin subunit and is thought to act as a chaperone protein. Studies in the mouse ortholog of this gene indicate that absence of this gene in mouse results in failed cardiac hypertrophy in response to mechanical stress. Alternative splicing results in multiple transcript variants encoding different isoforms, including an isoform that lacks several domains, including one of the CHORD domains. [provided by RefSeq, May 2017]

Uniprot Description

May play a role during maturation and/or organization of muscles cells.