Integrin alpha-L Recombinant Protein | Itgal recombinant protein

Recombinant Mouse Integrin alpha-L

Cat. Num. AAA968085

• Gene Names: Itgal; Cd11a; LFA-1; Ly-15; Ly-21; (p180); LFA-1A
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Integrin alpha-L; Recombinant Mouse Integrin alpha-L; CD11 antigen-like family member A; Leukocyte adhesion glycoprotein LFA-1 alpha chain; LFA-1A; Leukocyte function-associated molecule 1 alpha chain; Lymphocyte antigen 15; Ly-15; CD11a; Itgal recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 153-325aa; Partial
• Sequence: DLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDL
• Sequence Length: 1163

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Itgal recombinant protein

Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Is involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes. Mice expressing a null mutation of the alpha-L subunit gene donstrate impaired tumor rejection and impaired leukocytes recruitment.

References

Cloning of the murine lymphocyte function-associated molecule-1 alpha-subunit and its expression in COS cells.Kaufmann Y., Tseng E., Springer T.A.J. Immunol. 147:369-374(1991) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Sequence homology of the LFA-1 and Mac-1 leukocyte adhesion glycoproteins and unexpected relation to leukocyte interferon.Springer T.A., Teplow D.B., Dreyer W.J.Nature 314:540-542(1985)

NCBI and Uniprot Product Information

• NCBI GI #: 341940846
• NCBI GeneID: 16408
• UniProt Accession #: P24063
• Molecular Weight: 21.7 kDa
• NCBI Official Full Name: Integrin alpha-L
• NCBI Official Synonym Full Names: integrin alpha L
• NCBI Official Symbol: Itgal
• NCBI Official Synonym Symbols: Cd11a; LFA-1; Ly-15; Ly-21; (p180); LFA-1A
• NCBI Protein Information: integrin alpha-L
• UniProt Protein Name: Integrin alpha-L
• Protein Family: Integrin
• UniProt Gene Name: Itgal
• UniProt Synonym Gene Names: Lfa-1; Ly-15; LFA-1A; Ly-15
• UniProt Entry Name: ITAL_MOUSE

Uniprot Description

ITGAL: Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. It is involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes. Belongs to the integrin alpha chain family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; Motility/polarity/chemotaxis; Membrane protein, integral; Cell surface

Cellular Component: cell surface; external side of plasma membrane; immunological synapse; integral to membrane; integrin complex; intercellular junction; membrane

Molecular Function: cell adhesion molecule binding; ICAM-3 receptor activity; metal ion binding; protein complex binding; protein heterodimerization activity

Biological Process: activated T cell proliferation; cell adhesion; cell surface receptor linked signal transduction; cell-cell adhesion; cell-matrix adhesion; heterophilic cell adhesion; integrin-mediated signaling pathway; leukocyte adhesion; positive regulation of calcium-mediated signaling; positive regulation of cell-cell adhesion; positive regulation of T cell proliferation; receptor clustering; regulation of cell-cell adhesion; T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell