Integrin alpha5 Recombinant Protein | ITGA5 recombinant protein

Integrin alpha5 (CD49e) Recombinant Protein

Cat. Num. AAA3003782

• Gene Names: ITGA5; FNRA; CD49e; VLA5A
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: Integrin alpha5; Integrin alpha5 (CD49e) Recombinant Protein; ITGA5 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: PINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSY

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 378
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for ITGA5 recombinant protein

Background: Integrins are alpha/beta heterodimeric cell surface receptors that play a pivotal role in cell adhesion and migration, as well as in growth and survival. The integrin family contains at least 18 alpha and 8 beta subunits that form 24 known integrins with distinct tissue distribution and overlapping ligand specificities. Integrins not only transmit signals to cells in response to the extracellular environment (outside-in signaling), but also sense intracellular cues to alter their interaction with the extracellular environment (inside-out signaling). Integrin alpha5/beta1 is involved in multiple biological processes including embryonic development, angiogenesis and tumor metastasis. By interaction with its fibronectin ligand, alpha5/beta1 transduces signals that regulate cell adhesion, migration, matrix assembly and cytoskeletal organization.

NCBI and Uniprot Product Information

• NCBI GI #: 56237029
• NCBI GeneID: 3678
• NCBI Accession #: NP_002196.2
• NCBI GenBank Nucleotide #: NM_002205.2
• UniProt Accession #: P08648; Q96HA5
• Molecular Weight: 114,536 Da
• NCBI Official Full Name: integrin alpha-5
• NCBI Official Synonym Full Names: integrin, alpha 5 (fibronectin receptor, alpha polypeptide)
• NCBI Official Symbol: ITGA5
• NCBI Official Synonym Symbols: FNRA; CD49e; VLA5A
• NCBI Protein Information: integrin alpha-5; VLA-5; integrin alpha-F; CD49 antigen-like family member E; fibronectin receptor subunit alpha; fibronectin receptor, alpha subunit; very late activation protein 5, alpha subunit
• UniProt Protein Name: Integrin alpha-5
• Protein Family: Integrin
• UniProt Gene Name: ITGA5
• UniProt Synonym Gene Names: FNRA
• UniProt Entry Name: ITA5_HUMAN

NCBI Description

The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes the integrin alpha 5 chain. Alpha chain 5 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form a fibronectin receptor. In addition to adhesion, integrins are known to participate in cell-surface mediated signalling. [provided by RefSeq, Jul 2008]

Uniprot Description

ITGA5: Integrin alpha-5/beta-1 is a receptor for fibronectin and fibrinogen. It recognizes the sequence R-G-D in its ligands. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of an heavy and a light chain linked by a disulfide bond. Alpha-5 associates with beta-1. Interacts with HPS5 and NISCH. Interacts with RAB21 and COMP. Interacts with HIV- 1 Tat. Belongs to the integrin alpha chain family.

Protein type: Motility/polarity/chemotaxis; Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 12q11-q13

Cellular Component: ruffle; focal adhesion; cell surface; cytoplasm; plasma membrane; synapse; intercellular junction; integrin complex; external side of plasma membrane

Molecular Function: integrin binding; protein binding; vascular endothelial growth factor receptor 2 binding; metal ion binding; platelet-derived growth factor receptor binding; epidermal growth factor receptor binding

Biological Process: integrin-mediated signaling pathway; axon guidance; extracellular matrix organization and biogenesis; viral reproduction; cell-substrate adhesion; positive regulation of vascular endothelial growth factor receptor signaling pathway; memory; heterophilic cell adhesion; heterotypic cell-cell adhesion; leukocyte adhesion; positive regulation of peptidyl-tyrosine phosphorylation; cell-cell adhesion mediated by integrin; cell-substrate junction assembly; angiogenesis; cell adhesion; blood coagulation; leukocyte migration; wound healing, spreading of epidermal cells; positive regulation of cell migration