Iron sulfur cluster assembly protein 1, mitochondrial (ISU1) Recombinant Protein | ISU1 recombinant protein

Recombinant Saccharomyces cerevisiae Iron sulfur cluster assembly protein 1, mitochondrial (ISU1)

Cat. Num. AAA1251979

• Gene Names: ISU1; NUA1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Iron sulfur cluster assembly protein 1; mitochondrial (ISU1); Recombinant Saccharomyces cerevisiae Iron sulfur cluster assembly protein 1; ISU1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 28-165, full length protein
• Sequence: SSITKRLYHPKVIEHYTHPRNVGSLDKKLPNVGTGLVGAPACGDVMRLQIKVNDSTGVIEDVKFKTFGCGSAIASSSYMTELVQGMTLDDAAKIKNTEIAKELSLPPVKLHCSMLAEDAIKAAIKDYKSKRNTPTMLS
• Sequence Length: 138

• Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 6325122
• NCBI GeneID: 855968
• NCBI Accession #: NP_015190.1
• NCBI GenBank Nucleotide #: NM_001183949.1
• UniProt Accession #: Q03020; D6W3N2
• Molecular Weight: 17,895 Da
• NCBI Official Full Name: iron-binding protein ISU1
• NCBI Official Symbol: ISU1
• NCBI Official Synonym Symbols: NUA1
• NCBI Protein Information: iron-binding protein ISU1
• UniProt Protein Name: Iron sulfur cluster assembly protein 1, mitochondrial
• Protein Family: Iron sulfur cluster assembly protein
• UniProt Gene Name: ISU1
• UniProt Synonym Gene Names: NUA1

Uniprot Description

Scaffold protein for the de novo synthesis of iron-sulfur (Fe-S) clusters within mitochondria, which is required for maturation of both mitochondrial and cytoplasmic [2Fe-2S] and [4Fe-4S] proteins. First, a [2Fe-2S] cluster is transiently assembled on the scaffold proteins ISU1 and ISU2. In a second step, the cluster is released from ISU1/ISU2, transferred to glutaredoxin GRX5, followed by the formation of mitochondrial [2Fe-2S] proteins, the synthesis of [4Fe-4S] clusters and their target-specific insertion into the recipient apoproteins. Cluster assembly on ISU1/ISU2 depends on the function of the cysteine desulfurase complex NFS1-ISD11, which serves as the sulfur donor for cluster synthesis, the iron-binding protein frataxin (YFH1) as the putative iron donor, and the electron transfer chain comprised of ferredoxin reductase ARH1 and ferredoxin YAH1, which receive their electrons from NADH. Fe-S cluster release from ISU1/ISU2 is achieved by interaction with the Hsp70 chaperone SSQ1, assisted by the DnaJ-like co-chaperone JAC1 and the nucleotide exchange factor MGE1. ISU1 is the major isoform in yeast, while ISU2 is not detectable in cells grown to stationary phase (PubMed:10588895, PubMed:12970193, PubMed:14741370, PubMed:15123690, PubMed:16341089, PubMed:16431909, PubMed:23615440, PubMed:25358379).