Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase-like protein (Ispd) Recombinant Protein | Ispd recombinant protein

Recombinant Mouse 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase-like protein (Ispd)

Gene Names
Ispd; AV040780; 4930579E17Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase-like protein (Ispd); Recombinant Mouse 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase-like protein (Ispd); Ispd recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-447, full length protein
Sequence
MEPGPCSRPAEPGHCVSGPAGAGSAFPESPLSVAGAEPGNRPGTVAAVLPAGGCGERMGVRTPKQFCRVLERPLISYTLQAMERVCWIKDIVVTVTGENMEAMRSIIQRYGHKRISLAEAGATRHRSIFNGLKALAEDQPDCKLTKPEVVIIHDAVRPFVEEDILLRVVLAAKEHGAAGAIRPLVSTVISPSADGHLDHSLDRAKHRASEMPQAFLFDVIYEAYQQCSDFDLEFGTECLQLALKYCHRKAKLVEGPPALWKVTYKQDLCAAEAMIKEKISQEICVVMNTKDEESVGHLLEEALRKELNCMKITSTVMDHIGGDIRNFIEQCYSFICVNVVSPDSQETRKLLRILEESSLPLLYPVVVVLVHCFDFTSVPLAQKMESLVWIRGLAKEVKERNILLSGLLLNYSQDEQKLQESLGQSAAIIAALVKERNSALVGQLLVA
Sequence Length
447
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,292 Da
NCBI Official Full Name
D-ribitol-5-phosphate cytidylyltransferase isoform 2
NCBI Official Synonym Full Names
isoprenoid synthase domain containing
NCBI Official Symbol
Ispd
NCBI Official Synonym Symbols
AV040780; 4930579E17Rik
NCBI Protein Information
D-ribitol-5-phosphate cytidylyltransferase; isoprenoid synthase domain-containing protein
UniProt Protein Name
D-ribitol-5-phosphate cytidylyltransferase
UniProt Gene Name
Ispd

Uniprot Description

Cytidylyltransferase required for protein O-linked mannosylation. Catalyzes the formation of CDP-ribitol nucleotide sugar from D-ribitol 5-phosphate. CDP-ribitol is a substrate of FKTN during the biosynthesis of the phosphorylated O-mannosyl trisaccharide (N-acetylgalactosamine-beta-3-N-acetylglucosamine-beta-4-(phosphate-6-)mannose), a carbohydrate structure present in alpha-dystroglycan (DAG1), which is required for binding laminin G-like domain-containing extracellular proteins with high affinity. Shows activity toward other pentose phosphate sugars and mediates formation of CDP-ribulose or CDP-ribose using CTP and ribulose-5-phosphate or ribose-5-phosphate, respectively. Not Involved in dolichol production.

Research Articles on Ispd

Similar Products

Product Notes

The Ispd ispd (Catalog #AAA1482223) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-447, full length protein. The amino acid sequence is listed below: MEPGPCSRPA EPGHCVSGPA GAGSAFPESP LSVAGAEPGN RPGTVAAVLP AGGCGERMGV RTPKQFCRVL ERPLISYTLQ AMERVCWIKD IVVTVTGENM EAMRSIIQRY GHKRISLAEA GATRHRSIFN GLKALAEDQP DCKLTKPEVV IIHDAVRPFV EEDILLRVVL AAKEHGAAGA IRPLVSTVIS PSADGHLDHS LDRAKHRASE MPQAFLFDVI YEAYQQCSDF DLEFGTECLQ LALKYCHRKA KLVEGPPALW KVTYKQDLCA AEAMIKEKIS QEICVVMNTK DEESVGHLLE EALRKELNCM KITSTVMDHI GGDIRNFIEQ CYSFICVNVV SPDSQETRKL LRILEESSLP LLYPVVVVLV HCFDFTSVPL AQKMESLVWI RGLAKEVKER NILLSGLLLN YSQDEQKLQE SLGQSAAIIA ALVKERNSAL VGQLLVA. It is sometimes possible for the material contained within the vial of "2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase-like protein (Ispd), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.