Iron-sulfur cluster assembly enzyme ISCU, mitochondrial (Iscu) Recombinant Protein | Iscu recombinant protein

Recombinant Mouse Iron-sulfur cluster assembly enzyme ISCU, mitochondrial (Iscu)

Cat. Num. AAA1376684

• Gene Names: Iscu; Nifu; Nifun; AA407971; 2310020H20Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Iron-sulfur cluster assembly enzyme ISCU; mitochondrial (Iscu); Recombinant Mouse Iron-sulfur cluster assembly enzyme ISCU; Iscu recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 36-168, full length protein
• Sequence: YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQESKKEEPEKQ
• Sequence Length: 133

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Iscu recombinant protein

Iron-sulfur (Fe-S) clusters are necessary for several mitochondrial enzymes and other subcellular compartment proteins. They contain sulfur and iron, and are created via several steps that include cysteine desulfurases, iron donors, chaperones, and scaffold proteins. This gene encodes the two isomeric forms, ISCU1 and ISCU2, of the Fe-S cluster scaffold protein. Mutations in this gene have been found in patients with myopathy with severe exercise intolerance and myoglobinuria.

NCBI and Uniprot Product Information

• NCBI GI #: 21313484
• NCBI GeneID: 66383
• NCBI Accession #: NP_079802.1
• NCBI GenBank Nucleotide #: NM_025526.4
• UniProt Accession #: Q9D7P6; Q4VBC7; Q8K344
• Molecular Weight: 18,098 Da
• NCBI Official Full Name: iron-sulfur cluster assembly enzyme ISCU, mitochondrial
• NCBI Official Synonym Full Names: iron-sulfur cluster assembly enzyme
• NCBI Official Symbol: Iscu
• NCBI Official Synonym Symbols: Nifu; Nifun; AA407971; 2310020H20Rik
• NCBI Protein Information: iron-sulfur cluster assembly enzyme ISCU, mitochondrial
• UniProt Protein Name: Iron-sulfur cluster assembly enzyme ISCU, mitochondrial
• Protein Family: Iron-sulfur cluster assembly enzyme
• UniProt Gene Name: Iscu
• UniProt Synonym Gene Names: Nifun

Uniprot Description

Scaffold protein for the de novo synthesis of iron-sulfur (Fe-S) clusters within mitochondria, which is required for maturation of both mitochondrial and cytoplasmic [2Fe-2S] and [4Fe-4S] proteins. First, a [2Fe-2S] cluster is transiently assembled on the scaffold protein ISCU. In a second step, the cluster is released from ISCU, transferred to a glutaredoxin GLRX5, followed by the formation of mitochondrial [2Fe-2S] proteins, the synthesis of [4Fe-4S] clusters and their target-specific insertion into the recipient apoproteins. Cluster assembly on ISCU depends on the function of the cysteine desulfurase complex NFS1-LYRM4/ISD11, which serves as the sulfur donor for cluster synthesis, the iron-binding protein frataxin as the putative iron donor, and the electron transfer chain comprised of ferredoxin reductase and ferredoxin, which receive their electrons from NADH ().