Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interferon regulatory factor 1 (IRF1) Recombinant Protein | IRF1 recombinant protein

Recombinant Human Interferon regulatory factor 1 (IRF1)(K29R)

Gene Names
IRF1; MAR; IRF-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interferon regulatory factor 1 (IRF1); Recombinant Human Interferon regulatory factor 1 (IRF1)(K29R); IRF-1; IRF1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-325aa(K29R), Full Length
Sequence
MPITRMRMRPWLEMQINSNQIPGLIWINREEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP
Species
Homo sapiens (Human)
Relevance
Transcriptional regulator which displays a remarkable functional diversity in the regulation of cellular responses. These include the regulation of IFN and IFN-inducible genes, host response to viral and bacterial infections, regulation of many genes expressed during hematopoiesis, inflammation, immune responses and cell proliferation and differentiation, regulation of the cell cycle and induction of growth arrest and programmed cell death following DNA damage. Stimulates both innate and acquired immune responses through the activation of specific target genes and can act as a transcriptional activator and repressor regulating target genes by binding to an interferon-stimulated response element in their promoters. Its target genes for transcriptional activation activity include: genes involved in anti-viral response, such as IFN-alpha/beta, DDX58/RIG-I, TNFSF10/TRAIL, OAS1/2, PIAS1/GBP, EIF2AK2/PKR and RSAD2/viperin; antibacterial response, such as NOS2/INOS; anti-proliferative response, such as p53/TP53, LOX and CDKN1A; apoptosis, such as BBC3/PUMA, CASP1, CASP7 and CASP8; immune response, such as IL7, IL12A/B and IL15, PTGS2/COX2 and CYBB; DNA damage responses and DNA repair, such as POLQ/POLH; MHC class I expression, such as TAP1, PSMB9/LMP2, PSME1/PA28A, PSME2/PA28B and B2M and MHC class II expression, such as CIITA. Represses genes involved in anti-proliferative response, such as BIRC5/survivin, CCNB1, CCNE1, CDK1, CDK2 and CDK4 and in immune response, such as FOXP3, IL4, ANXA2 and TLR4. Stimulates p53/TP53-dependent transcription through enhanced recruitment of EP300 leading to increased acetylation of p53/TP53. Plays an important role in immune response directly affecting NK maturation and activity, macrophage production of IL12, Th1 development and maturation of CD8+ T-cells. Also implicated in the differentiation and maturation of dendritic cells and in the suppression of regulatory T cells development. Acts as a tumor suppressor and plays a role not only in antagonism of tumor cell growth but also in stimulating an immune response against tumor cells.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Product Categories/Family for IRF1 recombinant protein
References
"Sequence of a cDNA coding for human IRF-1."Maruyama M., Fujita T., Taniguchi T.Nucleic Acids Res. 17:3292-3292(1989)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,502 Da
NCBI Official Full Name
Homo sapiens interferon regulatory factor 1 (IRF1), mRNA
NCBI Official Synonym Full Names
interferon regulatory factor 1
NCBI Official Symbol
IRF1
NCBI Official Synonym Symbols
MAR; IRF-1
NCBI Protein Information
interferon regulatory factor 1; interferon regulatory factor 1 isoform +I9; interferon regulatory factor 1 isoform d78; interferon regulatory factor 1 isoform delta4; interferon regulatory factor 1 isoform delta7
UniProt Protein Name
Interferon regulatory factor 1
UniProt Gene Name
IRF1
UniProt Synonym Gene Names
IRF-1
UniProt Entry Name
IRF1_HUMAN

NCBI Description

IRF1 encodes interferon regulatory factor 1, a member of the interferon regulatory transcription factor (IRF) family. IRF1 serves as an activator of interferons alpha and beta transcription, and in mouse it has been shown to be required for double-stranded RNA induction of these genes. IRF1 also functions as a transcription activator of genes induced by interferons alpha, beta, and gamma. Further, IRF1 has been shown to play roles in regulating apoptosis and tumor-suppressoion. [provided by RefSeq, Jul 2008]

Uniprot Description

IRF1: a transcriptional regulator which displays a remarkable functional diversity in the regulation of cellular responses. These include the regulation of IFN and IFN-inducible genes, host response to viral and bacterial infections, regulation of many genes expressed during hematopoiesis, inflammation, immune responses and cell proliferation and differentiation, regulation of the cell cycle and induction of growth arrest and programmed cell death following DNA damage. Stimulates both innate and acquired immune responses through the activation of specific target genes and can act as a transcriptional activator and repressor regulating target genes by binding to an interferon- stimulated response element (ISRE) in their promoters. Its target genes for transcriptional activation activity include: genes involved in anti-viral response, such as IFN-alpha/beta, DDX58, TRAIL, OAS1/2, PIAS1, PKR and RSAD2; antibacterial response, such as iNOS; anti- proliferative response, such as p53, LOX and CDKN1A; apoptosis, such as PUMA, CASP1, CASP7 and CASP8; immune response, such as IL7, IL12A/B and IL15, COX-2 and CYBB; DNA damage responses and DNA repair, such as POLQ; MHC class I expression, such as TAP1, PSMB9, PSME1, PSME2 and B2M and MHC class II expression, such as CIITA. Represses genes involved in anti-proliferative response, such as survivin, CCNB1, CCNE1, CDK1, CDK2 and CDK4 and in immune response, such as FOXP3, IL4, ANXA2 and TLR4. Stimulates p53-dependent transcription through enhanced recruitment of EP300 leading to increased acetylation of p53. Plays an important role in immune response directly affecting NK maturation and activity, macrophage production of IL12, Th1 development and maturation of CD8+ T-cells. Also implicated in the differentiation and maturation of dendritic cells and in the suppression of regulatory T (Treg) cells development. Acts as a tumor suppressor and plays a role not only in antagonism of tumor cell growth but also in stimulating an immune response against tumor cells. Defects in IRF1 are a cause of gastric adenocarcinoma (GASC), accounting for most of all gastric malignant tumors. Deletions or rearrangements of IRF1 can occur in preleukemic myelodysplastic syndrome (MDS) and acute myelogenous leukemia (AML).

Protein type: Transcription factor; Tumor suppressor

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: nucleoplasm; cytoplasm; nuclear chromatin; cytosol; nucleus

Molecular Function: protein binding; DNA binding

Biological Process: transcription from RNA polymerase II promoter; CD8-positive, alpha-beta T cell differentiation; apoptosis; regulation of cell cycle; positive regulation of transcription, DNA-dependent; cytokine and chemokine mediated signaling pathway; regulation of MyD88-dependent toll-like receptor signaling pathway; regulation of innate immune response; negative regulation of cell proliferation; regulation of adaptive immune response; positive regulation of interleukin-12 biosynthetic process; negative regulation of regulatory T cell differentiation; positive regulation of interferon-beta production; positive regulation of interferon type I production; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; cell cycle arrest; blood coagulation; defense response to virus

Disease: Gastric Cancer; Lung Cancer

Research Articles on IRF1

Similar Products

Product Notes

The IRF1 irf1 (Catalog #AAA9018506) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-325aa(K29R), Full Length. The amino acid sequence is listed below: MPITRMRMRP WLEMQINSNQ IPGLIWINRE EMIFQIPWKH AAKHGWDINK DACLFRSWAI HTGRYKAGEK EPDPKTWKAN FRCAMNSLPD IEEVKDQSRN KGSSAVRVYR MLPPLTKNQR KERKSKSSRD AKSKAKRKSC GDSSPDTFSD GLSSSTLPDD HSSYTVPGYM QDLEVEQALT PALSPCAVSS TLPDWHIPVE VVPDSTSDLY NFQVSPMPST SEATTDEDEE GKLPEDIMKL LEQSEWQPTN VDGKGYLLNE PGVQPTSVYG DFSCKEEPEI DSPGGDIGLS LQRVFTDLKN MDATWLDSLL TPVRLPSIQA IPCAP. It is sometimes possible for the material contained within the vial of "Interferon regulatory factor 1 (IRF1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.