Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Ras GTPase-activating-like protein IQGAP1 (IQGAP1) Recombinant Protein | IQGAP1 recombinant protein

Recombinant Human Ras GTPase-activating-like protein IQGAP1 (IQGAP1) , partial

Gene Names
IQGAP1; SAR1; p195; HUMORFA01
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ras GTPase-activating-like protein IQGAP1 (IQGAP1); Recombinant Human Ras GTPase-activating-like protein IQGAP1 (IQGAP1); partial; IQGAP1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
505-717, Partial
Sequence
KAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNS
Sequence Length
717
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for IQGAP1 recombinant protein
This gene encodes a member of the IQGAP family. The protein contains four IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility. Expression of the protein is upregulated by gene amplification in two gastric cancer cell lines.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
189,252 Da
NCBI Official Full Name
ras GTPase-activating-like protein IQGAP1
NCBI Official Synonym Full Names
IQ motif containing GTPase activating protein 1
NCBI Official Symbol
IQGAP1
NCBI Official Synonym Symbols
SAR1; p195; HUMORFA01
NCBI Protein Information
ras GTPase-activating-like protein IQGAP1
UniProt Protein Name
Ras GTPase-activating-like protein IQGAP1
UniProt Gene Name
IQGAP1
UniProt Synonym Gene Names
KIAA0051

NCBI Description

This gene encodes a member of the IQGAP family. The protein contains four IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility. Expression of the protein is upregulated by gene amplification in two gastric cancer cell lines. [provided by RefSeq, Jul 2008]

Uniprot Description

Plays a crucial role in regulating the dynamics and assembly of the actin cytoskeleton. Binds to activated CDC42 but does not stimulate its GTPase activity. It associates with calmodulin. Could serve as an assembly scaffold for the organization of a multimolecular complex that would interface incoming signals to the reorganization of the actin cytoskeleton at the plasma membrane. May promote neurite outgrowth (PubMed:15695813). May play a possible role in cell cycle regulation by contributing to cell cycle progression after DNA replication arrest (PubMed:20883816).

Research Articles on IQGAP1

Similar Products

Product Notes

The IQGAP1 iqgap1 (Catalog #AAA954407) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 505-717, Partial. The amino acid sequence is listed below: KAQAHAENNE FITWNDIQAC VDHVNLVVQE EHERILAIGL INEALDEGDA QKTLQALQIP AAKLEGVLAE VAQHYQDTLI RAKREKAQEI QDESAVLWLD EIQGGIWQSN KDTQEAQKFA LGIFAINEAV ESGDVGKTLS ALRSPDVGLY GVIPECGETY HSDLAEAKKK KLAVGDNNSK WVKHWVKGGY YYYHNLETQE GGWDEPPNFV QNS . It is sometimes possible for the material contained within the vial of "Ras GTPase-activating-like protein IQGAP1 (IQGAP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.