Inositol-pentakisphosphate 2-kinase (ippk) Recombinant Protein | ippk recombinant protein
Recombinant Danio rerio Inositol-pentakisphosphate 2-kinase (ippk)
Gene Names
ippk; ipk1; ipk1l; zgc:110769; si:dkey-42i9.3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Inositol-pentakisphosphate 2-kinase (ippk); Recombinant Danio rerio Inositol-pentakisphosphate 2-kinase (ippk); ippk recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-483, Full length protein
Sequence
MELDKMDENDWKYHGEGNKSIVVSHLRHCQVLRLLKVPSEDSAHTRQTAEQTLRHILNIMDYSKHVMKPLLGEKYVHSGEVVRLPLDFLRQMSLKVQQERPELRCDKVMDTFSGCGLCLPDLTQLPLHHLRDHRPPICVEIKPKCGFLPFSRHMTKECKWKVCRFCMHQHYKLANGKWKRLSRYCPLDLFSGSKQRMYVALKNLLEEPQNNLKIFKGGELIFSCKDDAKQQPDLNNLIQHLRPYFPHTNGLYNGHQPGKVILNEFIQVICSALLSGGDSNRSGEPRKMHLSESKPHCEASPFPRDLIRNGHHGLPKDSVLAKILQVQMLDNLDIEGIYPLYKRVEQYLEEFPKERIRLQIDGPYDESFMDTVKSCLNEDDGSVEYAIGKVHQYRVAMTAKDCSVMITFAPCEEDEEHKLNLEKPRFTYSVSILDLDTKPYEGIPHQYKLDSKIVNYYLRSTQAPPPSSLYKERQECTLLFHAV
Sequence Length
483
Species
Zebrafish
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
56,028 Da
NCBI Official Full Name
inositol-pentakisphosphate 2-kinase
NCBI Official Synonym Full Names
inositol 1,3,4,5,6-pentakisphosphate 2-kinase
NCBI Official Symbol
ippk
NCBI Official Synonym Symbols
ipk1; ipk1l; zgc:110769; si:dkey-42i9.3
NCBI Protein Information
inositol-pentakisphosphate 2-kinase
UniProt Protein Name
Inositol-pentakisphosphate 2-kinase
UniProt Gene Name
ippk
UniProt Synonym Gene Names
ipk1; InsP5 2-kinase
Uniprot Description
Phosphorylates Ins(1,3,4,5,6)P5 at position 2 to form Ins(1,2,3,4,5,6)P6 (InsP6 or phytate). InsP6 is involved in many processes such as mRNA export, non-homologous end-joining, endocytosis and ion channel regulation. InsP6 also acts as a key regulator of left-right asymmetry in embryo, probably by regulating asymmetric Ca2+ during left-right specification.
Research Articles on ippk
Similar Products
Product Notes
The ippk ippk (Catalog #AAA1427602) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-483, Full length protein. The amino acid sequence is listed below: MELDKMDEND WKYHGEGNKS IVVSHLRHCQ VLRLLKVPSE DSAHTRQTAE QTLRHILNIM DYSKHVMKPL LGEKYVHSGE VVRLPLDFLR QMSLKVQQER PELRCDKVMD TFSGCGLCLP DLTQLPLHHL RDHRPPICVE IKPKCGFLPF SRHMTKECKW KVCRFCMHQH YKLANGKWKR LSRYCPLDLF SGSKQRMYVA LKNLLEEPQN NLKIFKGGEL IFSCKDDAKQ QPDLNNLIQH LRPYFPHTNG LYNGHQPGKV ILNEFIQVIC SALLSGGDSN RSGEPRKMHL SESKPHCEAS PFPRDLIRNG HHGLPKDSVL AKILQVQMLD NLDIEGIYPL YKRVEQYLEE FPKERIRLQI DGPYDESFMD TVKSCLNEDD GSVEYAIGKV HQYRVAMTAK DCSVMITFAP CEEDEEHKLN LEKPRFTYSV SILDLDTKPY EGIPHQYKLD SKIVNYYLRS TQAPPPSSLY KERQECTLLF HAV. It is sometimes possible for the material contained within the vial of "Inositol-pentakisphosphate 2-kinase (ippk), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
