Inosose dehydratase 1 (iolE1) Recombinant Protein | iolE1 recombinant protein

Recombinant Bacillus cereus Inosose dehydratase 1 (iolE1)

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

Inosose dehydratase 1 (iolE1); Recombinant Bacillus cereus Inosose dehydratase 1 (iolE1); iolE1 recombinant protein

Ordering
Cat. Num. AAA1314788 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

E Coli or Yeast or Baculovirus or Mammalian Cell

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Lyophilized or liquid (Format to be determined during the manufacturing process)

Sequence Positions

1-298, Full length

Sequence

MFKENTVKLGIAPIAWTNDDMPELGAGNTFEQCISEMALAGFNGSEVGNKYPRNTVVLKKSLALRNLEIASAWFSTFLTTKPLEETVEEFIKHRDFLHDMGAKVIVVSEQGHSIQGLMDVPLFKNKPVFTEEEWNKLADGLHHLGKLAQEKGLHIVYHHHMGTGVQTTAEIEKLMDMTNPALVSLLFDTGHLVFSGEEPLYILKKYLPRIKHVHLKDIRQEVVDTVKENELSFLQAVKNGAFTVPGDGVIGFDEVFTILANSDYQGWFVVEAEQDPALANPFEYALKARKFIQEKAGL

Sequence Length

298

Species

Bacillus cereus (strain ZK / E33L)

Preparation and Storage

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #

446394139

NCBI Accession #

WP_000471994.1

NCBI GenBank Nucleotide #

WP_000471994.1

UniProt Accession #

Q63B72

Molecular Weight

33,409 Da

NCBI Official Full Name

myo-inosose-2 dehydratase

UniProt Protein Name

Inosose dehydratase 1

Protein Family

Inosose dehydratase

UniProt Gene Name

iolE1

UniProt Synonym Gene Names

2KMI dehydratase 1

Uniprot Description

Catalyzes the dehydration of inosose (2-keto-myo-inositol, 2KMI or 2,4,6/3,5-pentahydroxycyclohexanone) to 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione (D-2,3-diketo-4-deoxy-epi-inositol).

Similar Products

Product Notes

The iolE1 iole1 (Catalog #AAA1314788) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-298, Full length. The amino acid sequence is listed below: MFKENTVKLG IAPIAWTNDD MPELGAGNTF EQCISEMALA GFNGSEVGNK YPRNTVVLKK SLALRNLEIA SAWFSTFLTT KPLEETVEEF IKHRDFLHDM GAKVIVVSEQ GHSIQGLMDV PLFKNKPVFT EEEWNKLADG LHHLGKLAQE KGLHIVYHHH MGTGVQTTAE IEKLMDMTNP ALVSLLFDTG HLVFSGEEPL YILKKYLPRI KHVHLKDIRQ EVVDTVKENE LSFLQAVKNG AFTVPGDGVI GFDEVFTILA NSDYQGWFVV EAEQDPALAN PFEYALKARK FIQEKAGL. It is sometimes possible for the material contained within the vial of "Inosose dehydratase 1 (iolE1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...