Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

VEGFR-2/Flk-1 (native), soluble Active Protein | VEGFR-2/Flk-1 active protein

Mouse VEGFR-2/Flk-1 (native), soluble

Gene Names
Kdr; Flk1; Ly73; Flk-1; Krd-1; VEGFR2; VEGFR-2; sVEGFR-2; 6130401C07
Reactivity
Mouse
Synonyms
VEGFR-2/Flk-1 (native); soluble; Mouse VEGFR-2/Flk-1 (native); soluble vascular endothelial growth factor receptor-2; Kdr; Flk1; Ly73; Flk-1; VEGF receptor 2; VEGFR-2; sVEGFR-2; VEGFR-2/Flk-1 active protein
Ordering
For Research Use Only!
Host
Insect Cells
Reactivity
Mouse
Form/Format
Lyophilized
Sequence
ASVGLTGDFLHPPKLSTQKDILTILANTTLQITCRGQRDLDWLWPNAQRD SEERVLVTECGGGDSIFCKTLTIPRVVGNDTGAYKCSYRDVDIASTVYVY VRDYRSPFIASVSDQHGIVYITENKNKTVVIPCRGSISNLNVSLCARYPE KRFVPDGNRISWDSEIGFTLPSYMISYAGMVFCEAKINDETYQSIMYIVV VVGYRIYDVILSPPHEIELSAGEKLVLNCTARTELNVGLDFTWHSPPSKS HHKKIVNRDVKPFPGTVAKMFLSTLTIESVTKSDQGEYTCVASSGRMIKR NRTFVRVHTKPFIAFGSGMKSLVEATVGSQVRIPVKYLSYPAPDIKWYRN GRPIESNYTMIVGDELTIMEVTERDAGNYTVILTNPISMEKQSHMVSLVV NVPPQIGEKALISPMDSYQYGTMQTLTCTVYANPPLHHIQWYWQLEEACS YRPGQTSPYACKEWRHVEDFQGGNKIEVTKNQYALIEGKNKTVSTLVIQA ANVSALYKCEAINKAGRGERVISFHVIRGPEITVQPAAQPTEQESVSLLC TADRNTFENLTWYKLGSQATSVHMGESLTPVCKNLDALWKLNGTMFSNST NDILIVAFQNASLQDQGDYVCSAQDKKTKKRHCLVKQLIILGMEASLGDR IAMP
Sequence Length
1367
N Terminal Sequence
ASVGLPGDFL
Biological Activity
Measured by its ability to inhibit the VEGF165-induced proliferation in human umbilical vein endothelial (HUVE) cells.
Reconstitution
The lyophilized mouse sFlk-1 is soluble in water and most aqueous buffers; it should be reconstituted in water or PBS to a concentration of not lower than 100ug/ml.
Preparation and Storage
The material is stable for greater than six months at -20 degree C to -70 degree C. After the first thawing it is recommended to aliquote the material, because repeated freeze-thaw cycles will decrease the activity. Store at 4 degree C not longer than 2 days.
Related Product Information for VEGFR-2/Flk-1 active protein
Disruption of the precise balance of positive and negative molecular regulators of blood and lymphatic vessel growth can lead to myriad diseases. Although dozens of natural inhibitors of hemangiogenesis have been identified, an endogenous selective inhibitor of lymphatic vessel growth has not to our knowledge been previously described. A splice variant of the gene encoding vascular endothelial growth factor receptor-2 (VEGFR-2) that encodes a secreted form of the protein, designated endogenous soluble VEGFR-2 (esVEGFR-2/KDR) has been described. The endogenous soluble esKDR inhibits developmental and reparative lymphangiogenesis by blocking VEGF-C function. Tissue-specific loss of esKDR in mice induced, at birth, spontaneous lymphatic invasion of the normally alymphatic cornea and hyperplasia of skin lymphatics without affecting blood vasculature. Administration of esKDR inhibited lymphangiogenesis but not hemangiogenesis induced by corneal suture injury or transplantation, enhanced corneal allograft survival and suppressed lymphangioma cellular proliferation. Naturally occurring esKDR thus acts as a molecular uncoupler of blood and lymphatic vessels; modulation of esKDR might have therapeutic effects in treating lymphatic vascular malformations, transplantation rejection and, potentially, tumor lymphangiogenesis and lymphedema. Recombinant human esKDR generated by alternative splicing consist of the first 6 Ig-like loops followed by the unique C-terminal end: GMEASLGDRIAMP.
Product Categories/Family for VEGFR-2/Flk-1 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
152,517 Da
NCBI Official Full Name
Vascular endothelial growth factor receptor 2
NCBI Official Synonym Full Names
kinase insert domain protein receptor
NCBI Official Symbol
Kdr
NCBI Official Synonym Symbols
Flk1; Ly73; Flk-1; Krd-1; VEGFR2; VEGFR-2; sVEGFR-2; 6130401C07
NCBI Protein Information
vascular endothelial growth factor receptor 2; kinase NYK; VEGF receptor-2; fetal liver kinase 1; protein-tyrosine kinase receptor flk-1; vascular endothelial growth factor receptor-2; vascular endothelial growth factor receptor-3; vascular endothelial growth factor receptor- 2; soluble vascular endothelial growth factor receptor 2
UniProt Protein Name
Vascular endothelial growth factor receptor 2
UniProt Gene Name
Kdr
UniProt Synonym Gene Names
Flk-1; Flk1; VEGFR-2; FLK-1
UniProt Entry Name
VGFR2_MOUSE

Uniprot Description

Function: Tyrosine-protein kinase that acts as a cell-surface receptor for VEGFA, VEGFC and VEGFD. Plays an essential role in the regulation of angiogenesis, vascular development, vascular permeability, and embryonic hematopoiesis. Promotes proliferation, survival, migration and differentiation of endothelial cells. Promotes reorganization of the actin cytoskeleton. Isoforms lacking a transmembrane domain, such as isoform 2, may function as decoy receptors for VEGFA, VEGFC and/or VEGFD. Isoform 2 plays an important role as a negative regulator of VEGFA- and VEGFC-mediated lymphangiogenesis by limiting the amount of free VEGFA and/or VEGFC and by preventing their binding to FLT4. Modulates FLT1 and FLT4 signaling by forming heterodimers. Binding of vascular growth factors to isoform 1 leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate and the activation of protein kinase C. Mediates activation of MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Mediates phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, reorganization of the actin cytoskeleton and activation of PTK2/FAK1. Required for VEGFA-mediated induction of NOS2 and NOS3, leading to the production of the signaling molecule nitric oxide (NO) by endothelial cells. Phosphorylates PLCG1. Promotes phosphorylation of FYN, NCK1, NOS3, PIK3R1, PTK2/FAK1 and SRC. Ref.4 Ref.6 Ref.7 Ref.9 Ref.13 Ref.15 Ref.16 Ref.17

Catalytic activity: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. Ref.10

Enzyme regulation: Present in an inactive conformation in the absence of bound ligand. Binding of VEGFA, VEGFC or VEGFD leads to dimerization and activation by autophosphorylation on tyrosine residues. May be regulated by hydrogen sulfide (H2S) levels via a sensitive intracellular disulfide bond

By similarity.

Subunit structure: Homodimer in the presence of bound dimeric VEGFA, VEGFC or VEGFD ligands; monomeric in the absence of bound ligands. Can also form heterodimers with FLT1/VEGFR1 and FLT4/VEGFR2. Interacts (tyrosine phosphorylated) with LFYN, NCK1, PLCG1. Interacts (tyrosine-phosphorylated active form preferentially) with DAB2IP (via C2 domain and active form preferentially); the interaction occurs at the late phase of VEGFA response and inhibits KDR/VEGFR2 activity. Interacts with SHBSH2D2A/TSAD, GRB2, MYOF, CBL and PDCD6. Ref.1 Ref.4 Ref.6 Ref.10 Ref.11 Ref.12 Ref.13 Ref.14

Subcellular location: Cell junction. Note: Localized with RAP1A at cell-cell junctions. Ref.4 Ref.13 Ref.15Isoform 1: Cell membrane; Single-pass type I membrane protein. Cytoplasm

By similarity. Nucleus

By similarity. Cytoplasmic vesicle

By similarity. Early endosome

By similarity. Note: Detected on caveolae-enriched lipid rafts at the cell surface. Is recycled from the plasma membrane to endosomes and back again. Phosphorylation triggered by VEGFA binding promotes internalization and subsequent degradation. VEGFA binding triggers internalization and translocation to the nucleus

By similarity. Ref.4 Ref.13 Ref.15Isoform 2: Secreted Ref.4 Ref.13 Ref.15.

Tissue specificity: Expressed in endothelial cells (at protein level). Detected in embryonic endothelial cells, as well as hematopoietic stem and progenitor cells. Detected in vascular endothelium. Expressed at high levels in adult heart, lung, kidney, brain and skeletal muscle, but is also expressed at lower levels in most other adult tissues. Ref.2 Ref.3 Ref.6 Ref.15

Developmental stage: Expressed in endothelial cells of allantois/umbilical vessels at 8.5 dpc (at protein level). Increases moderately during pregnancy (maximum 2.7-fold at 19 days), and increases further during lactation (maximum 3.7-fold increase on day 7). Ref.8 Ref.15

Domain: The second and third Ig-like C2-type (immunoglobulin-like) domains are sufficient for VEGFC binding

By similarity.

Post-translational modification: N-glycosylated

By similarity.Ubiquitinated. Tyrosine phosphorylation of the receptor promotes its poly-ubiquitination, leading to its degradation via the proteasome or lysosomal proteases

By similarity. Ref.13Autophosphorylated on tyrosine residues upon ligand binding. Autophosphorylation occurs in trans, i.e. one subunit of the dimeric receptor phosphorylates tyrosine residues on the other subunit. Phosphorylation at Tyr-949 is important for interaction with SH2D2A/TSAD and VEGFA-mediated reorganization of the actin cytoskeleton. Phosphorylation at Tyr-1173 is important for interaction with PLCG1 and SHB. Phosphorylation at Tyr-1212 is important for interaction with NCK1 and FYN. Dephosphorylated by PTPRJ at Tyr-799, Tyr-949, Tyr-994, Tyr-1052, Tyr-1057, Tyr-1173 and Tyr-1212

By similarity. Ref.6 Ref.9 Ref.13The inhibitory disulfide bond between Cys-1022 and Cys-1043 may serve as a specific molecular switch for H2S-induced modification that regulates VEGFR2 function

By similarity.

Disruption phenotype: Embryonic lethality at 8.5 to 9.5 dpc, due to early defects in the development of hematopoietic and endothelial cells, leading to defects in vasculogenesis and endocardium development. At 7.5 dpc, there are no blood islands in the yolk sac. Organized blood vessels are absent in the yolk sac and in the embryo. Ref.7

Sequence similarities: Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.Contains 7 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 protein kinase domain.

Research Articles on VEGFR-2/Flk-1

Similar Products

Product Notes

The VEGFR-2/Flk-1 kdr (Catalog #AAA691679) is an Active Protein produced from Insect Cells and is intended for research purposes only. The product is available for immediate purchase. The Mouse VEGFR-2/Flk-1 (native), soluble reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: ASVGLTGDFL HPPKLSTQKD ILTILANTTL QITCRGQRDL DWLWPNAQRD SEERVLVTEC GGGDSIFCKT LTIPRVVGND TGAYKCSYRD VDIASTVYVY VRDYRSPFIA SVSDQHGIVY ITENKNKTVV IPCRGSISNL NVSLCARYPE KRFVPDGNRI SWDSEIGFTL PSYMISYAGM VFCEAKINDE TYQSIMYIVV VVGYRIYDVI LSPPHEIELS AGEKLVLNCT ARTELNVGLD FTWHSPPSKS HHKKIVNRDV KPFPGTVAKM FLSTLTIESV TKSDQGEYTC VASSGRMIKR NRTFVRVHTK PFIAFGSGMK SLVEATVGSQ VRIPVKYLSY PAPDIKWYRN GRPIESNYTM IVGDELTIME VTERDAGNYT VILTNPISME KQSHMVSLVV NVPPQIGEKA LISPMDSYQY GTMQTLTCTV YANPPLHHIQ WYWQLEEACS YRPGQTSPYA CKEWRHVEDF QGGNKIEVTK NQYALIEGKN KTVSTLVIQA ANVSALYKCE AINKAGRGER VISFHVIRGP EITVQPAAQP TEQESVSLLC TADRNTFENL TWYKLGSQAT SVHMGESLTP VCKNLDALWK LNGTMFSNST NDILIVAFQN ASLQDQGDYV CSAQDKKTKK RHCLVKQLII LGMEASLGDR IAMP. It is sometimes possible for the material contained within the vial of "VEGFR-2/Flk-1 (native), soluble, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.