BMP receptor-1A, soluble Active Protein | BMP receptor-1A active protein

Human BMP receptor-1A, soluble

Cat. Num. AAA691658

• Gene Names: BMPR1A; ALK3; SKR5; CD292; ACVRLK3; 10q23del
• Reactivity: Human
• Purity: > 90% by SDS-PAGE & silver stain
• Synonyms: BMP receptor-1A; soluble; Human BMP receptor-1A; Recombinant Human Soluble BMP Receptor Type-1A; Bone morphogenetic protein receptor type-1A; Activin receptor-like kinase 3; CD292; BMP receptor-1A active protein

• Host: Insect Cells
• Reactivity: Human
• Purity/Purification: > 90% by SDS-PAGE & silver stain
• Form/Format: Lyophilized
• Sequence: QNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAIN NTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIE CCRTNLCNQYLQPTLPPVVIGPFFDGSIRHHHHHH
• Sequence Length: 135

• Buffer: PBS
• Reconstitution: The lyophilized sBMPR-1A is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium to a concentration not lower than 50ug/ml.
• Biological Activity: Measured by its ability to inhibit recombinant human BMP-2 induced alkaline phosphatase production by C2C12 myogenic cells. The ED₅₀ for this effect is typically 1-4 ug/ml in the presence of 500ng/ml of recombinant human BMP-2.
• Preparation and Storage: Lyophilized samples are stable for greater than six months at -20 degree C to -70 degree C. Reconstituted sBMPR-1A should be stored in working aliquots at -20 degree C.

Testing Data

Testing Data 2

(BMP-2 BioLISA using recombinant human soluble BMPR-IA for capturing and recombinant human BMP-2 as standard. A rabbit anti-human BMP-2 antibody in combination with an goat anti-rabbit Biotin antibody was used for detection. )

Testing Data 3

(C2C12 cells were plated with 1500c/well in a 96well plate. Cells were stimulated with O.5).lg/ml BMP-2 and increasing amounts of recombinant human soluble BMPR-IA were added. The cells were incubated at 37 degree C, 5% C02 for 4 days.)

Related Product Information for BMP receptor-1A active protein

The extracellular domain of human BMPR-IA was fused with a carboxy-terminal 6X histidine-tag. The monomeric glycoprotein was expressed in baculovirus infected insect cells. Cellular responses to bone morphogenetic proteins (BMPs) have been shown to be mediated by the formation of hetero-oligomeric complexes of the type I and type II serine/threonine kinase receptors. BMP receptor 1A (BMPR-1A), also known as activin receptor-like kinase (ALK)-3, is a one of seven known type I serine/threonine kinases that are required for the signal transduction of TGF-b family cytokines. In contrast to the TGF-b receptor system in which the type I receptor does not bind TGF-b in the absence of the type II receptor, type I receptors involved in BMP signaling (including BMPR-IA, BMPR-IB/ALK-6, and ActR-I/ALK-2) can independently bind the various BMP family proteins in the absence of type II receptors. Recombinant soluble BMPR-IA binds BMP-2 and -4 with high-affinity in solution and is a potent BMP-2/4 antagonist in vitro. BMPR-IA is ubiquitously expressed during embryogenesis. In adult tissues, BMPR-IA mRNA is also widely distributed; with the highest expression levels found in skeletal muscle. The extracellular domain of BMPR-IA shares little amino acid sequence identity with the other mammalian ALK type I receptor kinases, but the cysteine residues are conserved. Human and mouse BMPR-IA are highly conserved and share 98% sequence identity.

Product Categories/Family for BMP receptor-1A active protein

Soluble receptors

References

1. Wu MY and CS Hill Dev Cell 16:329, 2009 2. Nickel J et al, Cytokine Growth Factor Rev 20:367, 2009 3. de Caestecker M, Cytokine Growth Factor Rev 15:1, 2004 4. Schmal H et al, Cytotherapy 14(7):868-76, 2012 5. Liu R etal, BMC Musculoskelet Disord 15;10:51, 2009

NCBI and Uniprot Product Information

• NCBI GI #: 41349437
• NCBI GeneID: 657
• NCBI Accession #: NP_033888
• NCBI GenBank Nucleotide #: NM_009758
• UniProt Accession #: P36894; Q8NEN8; A8K6U9
• Molecular Weight: 23 kDa (Monomer)
• NCBI Official Full Name: bone morphogenetic protein receptor type-1A
• NCBI Official Synonym Full Names: bone morphogenetic protein receptor, type IA
• NCBI Official Symbol: BMPR1A
• NCBI Official Synonym Symbols: ALK3; SKR5; CD292; ACVRLK3; 10q23del
• NCBI Protein Information: bone morphogenetic protein receptor type-1A; ALK-3; BMPR-1A; BMP type-1A receptor; activin receptor-like kinase 3; activin A receptor, type II-like kinase 3; serine/threonine-protein kinase receptor R5
• UniProt Protein Name: Bone morphogenetic protein receptor type-1A
• UniProt Gene Name: BMPR1A
• UniProt Synonym Gene Names: ACVRLK3; ALK3; BMP type-1A receptor; BMPR-1A; ALK-3; SKR5
• UniProt Entry Name: BMR1A_HUMAN

NCBI Description

The bone morphogenetic protein (BMP) receptors are a family of transmembrane serine/threonine kinases that include the type I receptors BMPR1A and BMPR1B and the type II receptor BMPR2. These receptors are also closely related to the activin receptors, ACVR1 and ACVR2. The ligands of these receptors are members of the TGF-beta superfamily. TGF-betas and activins transduce their signals through the formation of heteromeric complexes with 2 different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for BMP-2 and BMP-4.

Catalytic activity: ATP + [receptor-protein] = ADP + [receptor-protein] phosphate.

Cofactor: Magnesium or manganese

By similarity.

Subcellular location: Membrane; Single-pass type I membrane protein.

Tissue specificity: Highly expressed in skeletal muscle.

Involvement in disease: Juvenile polyposis syndrome (JPS) [MIM:174900]: Autosomal dominant gastrointestinal hamartomatous polyposis syndrome in which patients are at risk for developing gastrointestinal cancers. The lesions are typified by a smooth histological appearance, predominant stroma, cystic spaces and lack of a smooth muscle core. Multiple juvenile polyps usually occur in a number of Mendelian disorders. Sometimes, these polyps occur without associated features as in JPS; here, polyps tend to occur in the large bowel and are associated with an increased risk of colon and other gastrointestinal cancers.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.6 Ref.7 Ref.8 Ref.9 Ref.10Polyposis syndrome, mixed hereditary 2 (HMPS2) [MIM:610069]: A disease is characterized by atypical juvenile polyps, colonic adenomas, and colorectal carcinomas.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.6A microdeletion of chromosome 10q23 involving BMPR1A and PTEN is a cause of chromosome 10q23 deletion syndrome, which shows overlapping features of the following three disorders: Bannayan-Zonana syndrome, Cowden disease and juvenile polyposis syndrome. Ref.6

Sequence similarities: Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.Contains 1 GS domain.Contains 1 protein kinase domain.