Indolethylamine N-methyltransferase (Inmt) Recombinant Protein | Inmt recombinant protein
Recombinant Mouse Indolethylamine N-methyltransferase (Inmt)
Gene Names
Inmt; Temt
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Indolethylamine N-methyltransferase (Inmt); Recombinant Mouse Indolethylamine N-methyltransferase (Inmt); Inmt recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-264aa; Full-Length
Sequence
MEGKVYIGGEDYEKEFTPKDYLTTYYSFHSGPVAEQEIVKFSLQNLYQTFSTGGVGGDVLIDIGSGPTIYQLLSACEVFREIIVTDYTPQNLQELQKWLKKEPGAYDWSSIVQHACELEGDRSRWQEKEAKLRRTVTRVLRCDVTKTPPLGSAQVPLADCVLTFLAMECACPDIDTYRAALRRLAGLLKPGGHLVTLVTLRFQHYMVGPKKFSGVYLEKEVVEKAIQDAGCQVLKCNCVSLSYSEAYCSHDGLCFVVARKGPSA
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Inmt recombinant protein
N-methylation of endogenous and xenobiotic compounds is a major method by which they are degraded. This gene encodes an enzyme that N-methylates indoles such as tryptamine.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29,460 Da
NCBI Official Full Name
indolethylamine N-methyltransferase
NCBI Official Synonym Full Names
indolethylamine N-methyltransferase
NCBI Official Symbol
Inmt
NCBI Official Synonym Symbols
Temt
NCBI Protein Information
indolethylamine N-methyltransferase
UniProt Protein Name
Indolethylamine N-methyltransferase
Protein Family
UniProt Gene Name
Inmt
UniProt Synonym Gene Names
Temt; Indolamine N-methyltransferase; Amine N-methyltransferase; Arylamine N-methyltransferase; TEMT
Uniprot Description
Catalyzes the N-methylation of tryptamine and structurally related compounds (). Functions as thioether S-methyltransferase and is active with a variety of thioethers and the corresponding selenium and tellurium compounds, including 3-methylthiopropionaldehyde, dimethyl selenide, dimethyl telluride, 2-methylthioethylamine, 2-methylthioethanol, methyl-n-propyl sulfide and diethyl sulfide. Plays an important role in the detoxification of selenium compounds.
Research Articles on Inmt
Similar Products
Product Notes
The Inmt inmt (Catalog #AAA961746) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-264aa; Full-Length. The amino acid sequence is listed below: MEGKVYIGGE DYEKEFTPKD YLTTYYSFHS GPVAEQEIVK FSLQNLYQTF STGGVGGDVL IDIGSGPTIY QLLSACEVFR EIIVTDYTPQ NLQELQKWLK KEPGAYDWSS IVQHACELEG DRSRWQEKEA KLRRTVTRVL RCDVTKTPPL GSAQVPLADC VLTFLAMECA CPDIDTYRAA LRRLAGLLKP GGHLVTLVTL RFQHYMVGPK KFSGVYLEKE VVEKAIQDAG CQVLKCNCVS LSYSEAYCSH DGLCFVVARK GPSA . It is sometimes possible for the material contained within the vial of "Indolethylamine N-methyltransferase (Inmt), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
