Mitochondrial inner membrane protease subunit 1 (IMP1) Recombinant Protein | IMP1 recombinant protein

Recombinant Saccharomyces cerevisiae Mitochondrial inner membrane protease subunit 1 (IMP1)

Cat. Num. AAA1123545

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Mitochondrial inner membrane protease subunit 1 (IMP1); Recombinant Saccharomyces cerevisiae Mitochondrial inner membrane protease subunit 1 (IMP1); IMP1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-190, full length protein
• Sequence: TVGTLPIWSKTFSYAIRSLCFLHIIHMYAYEFTETRGESMLPTLSATNDYVHVLKNFQNGRGIKMGDCIVALKPTDPNHRICKRVTGMPGDLVLVDPSTIVNYVGDVLVDEERFGTYIKVPEGHVWVTGDNLSHSLDSRTYNALPMGLIMGKIVAANNFDKPFWDGSIRNIWGFKWINNTFLDVQAKSN
• Sequence Length: 189

• Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 6323800
• NCBI GeneID: 855182
• NCBI Accession #: NP_013870.1
• NCBI GenBank Nucleotide #: NM_001182652.1
• UniProt Accession #: P28627; D6VZX2; E9P8W1
• Molecular Weight: 21,433 Da
• NCBI Official Full Name: endopeptidase catalytic subunit IMP1
• NCBI Official Symbol: IMP1
• NCBI Protein Information: endopeptidase catalytic subunit IMP1
• UniProt Protein Name: Mitochondrial inner membrane protease subunit 1
• Protein Family: Mitochondrial inner membrane protease
• UniProt Gene Name: IMP1
• UniProt Synonym Gene Names: PET2858

Uniprot Description

Catalytic component of the mitochondrial inner membrane peptidase (IMP) complex. IMP catalyzes the removal of signal peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space. The two catalytic IMP subunits seem to have non-overlapping substrate specificities. IMP1 substrates include nuclear encoded CYB2, mitochondrially encoded COX2, NADH-cytochrome b5 reductase and GUT2.