Interleukin-8 Recombinant Protein | IL8 recombinant protein

Recombinant human Interleukin-8 protein

Cat. Num. AAA717058

• Gene Names: IL8; NAF; GCP1; LECT; LUCT; NAP1; CXCL8; GCP-1; LYNAP; MDNCF; MONAP; NAP-1
• Applications: ELISA, Western Blot
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-8; Recombinant human Interleukin-8 protein; Interleukin-8 His tagged; IL8 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence: EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

• Applicable Applications for IL8 recombinant protein: ELISA, Western Blot
• Preparation and Storage: Store working aliquots at 4 degree C for up to one week. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended.

Related Product Information for IL8 recombinant protein

IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.

References

[1] "The neutrophil-activating proteins interleukin 8 and beta-thromboglobulin: in vitro and in vivo comparison of NH2-terminally processed forms." van Damme J., Rampart M., Coning R., Decock B., van Osselaer N., Willems J., Billiau A. Eur. J. Immunol. 20:2113-2118(1990)
[2] "Biochemical and biological characterization of NAP-1/IL-8-related cytokines in lesional psoriatic scale." Schroeder J.-M. Adv. Exp. Med. Biol. 305:97-107(1991)

NCBI and Uniprot Product Information

• NCBI GI #: 324073503
• NCBI GeneID: 3576
• NCBI Accession #: NP_000575.1
• NCBI GenBank Nucleotide #: NM_000584.3
• UniProt Accession #: P10145; Q6FGF6; Q6LAE6; Q96RG6; Q9C077; Q9UCE1; Q9UCR8; Q9UCR9; Q9UCS0; B2R4L8
• Molecular Weight: 13 KD
• NCBI Official Full Name: Homo sapiens interleukin 8 (IL8), mRNA
• NCBI Official Synonym Full Names: interleukin 8
• NCBI Official Symbol: IL8
• NCBI Official Synonym Symbols: NAF; GCP1; LECT; LUCT; NAP1; CXCL8; GCP-1; LYNAP; MDNCF; MONAP; NAP-1
• NCBI Protein Information: interleukin-8; emoctakin; OTTHUMP00000199824; OTTHUMP00000199825; C-X-C motif chemokine 8; T cell chemotactic factor; T-cell chemotactic factor; neutrophil-activating peptide 1; chemokine (C-X-C motif) ligand 8; beta-thromboglobulin-like protein; granulocyte chemotactic protein 1; tumor necrosis factor-induced gene 1; alveolar macrophage chemotactic factor I; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; small inducible cytokine subfamily B, member 8; lymphocyte-derived neutrophil-activating factor; lymphocyte derived neutrophil activating peptide; lung giant cell carcinoma-derived chemotactic protein; beta endothelial cell-derived neutrophil activating peptide
• UniProt Protein Name: Interleukin-8
• Protein Family: Interleukin
• UniProt Gene Name: IL8
• UniProt Synonym Gene Names: CXCL8
• UniProt Entry Name: IL8_HUMAN

NCBI Description

The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively. Ref.15 Ref.24 Ref.27Subunit structure: Homodimer.Subcellular location: Secreted. Post-translational modification: Several N-terminal processed forms are produced by proteolytic cleavage after secretion from at least peripheral blood monocytes, leukcocytes and endothelial cells. In general, IL-8(1-77) is referred to as interleukin-8. IL-8(6-77) is the most promiment form.Sequence similarities: Belongs to the intercrine alpha (chemokine CxC) family.