Interleukin-24 (IL24) Recombinant Protein | IL24 recombinant protein
Recombinant Human Interleukin-24 (IL24)
Gene Names
IL24; C49A; FISP; MDA7; MOB5; ST16; IL10B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-24 (IL24); Recombinant Human Interleukin-24 (IL24); IL24 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
52-206, Full length protein
Sequence
QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL
Sequence Length
155
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for IL24 recombinant protein
This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. This protein can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7
P38), and heat shock 27kDa protein 1 (HSPB2
HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
P38), and heat shock 27kDa protein 1 (HSPB2
HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
7,347 Da
NCBI Official Full Name
interleukin-24 isoform 3
NCBI Official Synonym Full Names
interleukin 24
NCBI Official Symbol
IL24
NCBI Official Synonym Symbols
C49A; FISP; MDA7; MOB5; ST16; IL10B
NCBI Protein Information
interleukin-24
UniProt Protein Name
Interleukin-24
Protein Family
UniProt Gene Name
IL24
UniProt Synonym Gene Names
MDA7; ST16; IL-24; MDA-7
NCBI Description
This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Uniprot Description
Has antiproliferative properties on melanoma cells and may contribute to terminal cell differentiation.
Research Articles on IL24
Similar Products
Product Notes
The IL24 il24 (Catalog #AAA1387316) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 52-206, Full length protein. The amino acid sequence is listed below: QEFHFGPCQV KGVVPQKLWE AFWAVKDTMQ AQDNITSARL LQQEVLQNVS DAESCYLVHT LLEFYLKTVF KNYHNRTVEV RTLKSFSTLA NNFVLIVSQL QPSQENEMFS IRDSAHRRFL LFRRAFKQLD VEAALTKALG EVDILLTWMQ KFYKL. It is sometimes possible for the material contained within the vial of "Interleukin-24 (IL24), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
