Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Interleukin-23 subunit alpha (Il23a) Recombinant Protein | Il23a recombinant protein

Recombinant Mouse Interleukin-23 subunit alpha (Il23a)

Gene Names
Il23a; p19; IL-23
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-23 subunit alpha (Il23a); Recombinant Mouse Interleukin-23 subunit alpha (Il23a); Interleukin-23 subunit p19; IL-23p19; Il23a recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
22-196aa; Full Length
Sequence
VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA
Sequence Length
196
Species
Mus musculus (Mouse)
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for Il23a recombinant protein
Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
Product Categories/Family for Il23a recombinant protein
References
"Ubiquitous transgenic expression of the IL-23 subunit p19 induces multiorgan inflammation, runting, infertility, and premature death." Wiekowski M.T., Leach M.W., Evans E.W., Sullivan L., Chen S.-C., Vassileva G., Bazan J.F., Gorman D.M., Kastelein R.A., Narula S., Lira S.A.J. Immunol. 166:7563-7570(2001)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23.7 kDa
NCBI Official Full Name
interleukin-23 subunit alpha
NCBI Official Synonym Full Names
interleukin 23, alpha subunit p19
NCBI Official Symbol
Il23a
NCBI Official Synonym Symbols
p19; IL-23
NCBI Protein Information
interleukin-23 subunit alpha
UniProt Protein Name
Interleukin-23 subunit alpha
Protein Family
UniProt Gene Name
Il23a
UniProt Synonym Gene Names
IL-23 subunit alpha; IL-23-A; IL-23p19

Uniprot Description

Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.

Research Articles on Il23a

Similar Products

Product Notes

The Il23a il23a (Catalog #AAA7053577) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-196aa; Full Length. The amino acid sequence is listed below: VPRSSSPDWA QCQQLSRNLC MLAWNAHAPA GHMNLLREEE DEETKNNVPR IQCEDGCDPQ GLKDNSQFCL QRIRQGLAFY KHLLDSDIFK GEPALLPDSP MEQLHTSLLG LSQLLQPEDH PRETQQMPSL SSSQQWQRPL LRSKILRSLQ AFLAIAARVF AHGAATLTEP LVPTA. It is sometimes possible for the material contained within the vial of "Interleukin-23 subunit alpha (Il23a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.