Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human IL-22BP/IL-22RA2 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 40-50 kDa.)

IL-22BP/IL-22RA2 Recombinant Protein | IL22RA2 recombinant protein

Recombinant Human IL-22BP/IL-22RA2 Protein

Gene Names
IL22RA2; CRF2X; CRF2-10; CRF2-S1; IL-22BP; IL-22RA2; ZCYTOR16; IL-22R-alpha-2
Purity
>90% by SDS-PAGE.
Synonyms
IL-22BP/IL-22RA2; Recombinant Human IL-22BP/IL-22RA2 Protein; CRF2-10; CRF2-S1; CRF2X; IL-22BP; IL-22R-alpha-2; IL-22RA2; ZCYTOR16; IL22RA2 recombinant protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>90% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
TQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP
Sequence Length
231
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human IL-22BP/IL-22RA2 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 40-50 kDa.)

SDS-Page (Recombinant Human IL-22BP/IL-22RA2 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 40-50 kDa.)
Related Product Information for IL22RA2 recombinant protein
Description: Recombinant Human IL-22BP/IL-22RA2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr22-Pro231) of human IL-22BP/IL-22RA2 (Accession #NP_851826.1) fused with a 6xHis tag at the C-terminus.

Background: Interleukin 22 binding protein (IL-22BP), also known as CRF2-10, CRF2-X, and IL-22RA2, is a 35-45 kDa secreted glycoprotein in the type II cytokine receptor family (CRF). IL-22BP specifically binds to and inhibits interleukin 22 activity by blocking the interaction of interleukin 22 with its cell surface receptor.IL-22BP is produced by dendritic cells (DC), epithelial cells, activated B cells, and activated monocytes. It is constitutively expressed by DC but is down-regulated during local inflammation and in response to tissue damage. IL-22BP is critical for limiting IL-22 induced epithelial cell proliferation during wound healing, and its deficiency can enable uncontrolled proliferation and enhance tumor development.
Product Categories/Family for IL22RA2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-22 receptor subunit alpha-2 isoform 2
NCBI Official Synonym Full Names
interleukin 22 receptor subunit alpha 2
NCBI Official Symbol
IL22RA2
NCBI Official Synonym Symbols
CRF2X; CRF2-10; CRF2-S1; IL-22BP; IL-22RA2; ZCYTOR16; IL-22R-alpha-2
NCBI Protein Information
interleukin-22 receptor subunit alpha-2
UniProt Protein Name
Interleukin-22 receptor subunit alpha-2
Protein Family
UniProt Gene Name
IL22RA2
UniProt Synonym Gene Names
IL-22 receptor subunit alpha-2; IL-22R-alpha-2; IL-22RA2; CRF2-10; CRF2-S1; IL-22BP; IL22BP
UniProt Entry Name
I22R2_HUMAN

NCBI Description

This gene encodes a member of the class II cytokine receptor family. The encoded soluble protein specifically binds to and inhibits interleukin 22 activity by blocking the interaction of interleukin 22 with its cell surface receptor. The encoded protein may be important in the regulation of inflammatory response, and has been implicated in the regulation of tumorigenesis in the colon. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2013]

Research Articles on IL22RA2

Similar Products

Product Notes

The IL22RA2 il22ra2 (Catalog #AAA9141775) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: TQSTHESLKP QRVQFQSRNF HNILQWQPGR ALTGNSSVYF VQYKIYGQRQ WKNKEDCWGT QELSCDLTSE TSDIQEPYYG RVRAASAGSY SEWSMTPRFT PWWETKIDPP VMNITQVNGS LLVILHAPNL PYRYQKEKNV SIEDYYELLY RVFIINNSLE KEQKVYEGAH RAVEIEALTP HSSYCVVAEI YQPMLDRRSQ RSEERCVEIP. It is sometimes possible for the material contained within the vial of "IL-22BP/IL-22RA2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.