Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Interleukin-1 beta (IL1B) Recombinant Protein | IL1B recombinant protein

Recombinant Human Interleukin-1 beta (IL1B)

Gene Names
IL1B; IL-1; IL1F2; IL1-BETA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-1 beta (IL1B); Recombinant Human Interleukin-1 beta (IL1B); Interleukin-1 beta; IL-1 beta; Catabolin; IL1B recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
117-269. Full Length of Mature Protein
Sequence
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Species
Homo sapiens (Human)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for IL1B recombinant protein
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Product Categories/Family for IL1B recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33.4 kDa
NCBI Official Full Name
interleukin-1 beta proprotein
NCBI Official Synonym Full Names
interleukin 1, beta
NCBI Official Symbol
IL1B
NCBI Official Synonym Symbols
IL-1; IL1F2; IL1-BETA
NCBI Protein Information
interleukin-1 beta; IL-1 beta; catabolin; preinterleukin 1 beta; pro-interleukin-1-beta
UniProt Protein Name
Interleukin-1 beta
Protein Family
UniProt Gene Name
IL1B
UniProt Synonym Gene Names
IL1F2; IL-1 beta
UniProt Entry Name
IL1B_HUMAN

NCBI Description

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, Jul 2008]

Uniprot Description

IL1B: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. Monomer. Belongs to the IL-1 family.

Protein type: Cytokine

Chromosomal Location of Human Ortholog: 2q14

Cellular Component: extracellular space; extracellular region; cytosol; secretory granule

Molecular Function: protein domain specific binding; interleukin-1 receptor binding; cytokine activity

Biological Process: positive regulation of granulocyte macrophage colony-stimulating factor production; negative regulation of MAP kinase activity; positive regulation of nitric oxide biosynthetic process; activation of MAPK activity; positive regulation of interleukin-2 biosynthetic process; positive regulation of transcription, DNA-dependent; germ cell programmed cell death; negative regulation of insulin receptor signaling pathway; positive regulation of NF-kappaB import into nucleus; positive regulation of lipid catabolic process; fever; positive regulation of membrane protein ectodomain proteolysis; response to carbohydrate stimulus; activation of NF-kappaB transcription factor; cell-cell signaling; positive regulation of phagocytosis; positive regulation of T cell mediated immunity; positive regulation of T cell proliferation; neutrophil chemotaxis; positive regulation of heterotypic cell-cell adhesion; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of mitosis; smooth muscle adaptation; interleukin-1 beta production; positive regulation of interleukin-6 production; positive regulation of angiogenesis; positive regulation of transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; negative regulation of lipid metabolic process; sequestering of triacylglycerol; positive regulation of histone phosphorylation; apoptosis; positive regulation of interleukin-6 biosynthetic process; positive regulation of JNK cascade; signal transduction; positive regulation of vascular endothelial growth factor receptor signaling pathway; positive regulation of interleukin-8 production; positive regulation of protein export from nucleus; negative regulation of cell proliferation; negative regulation of lipid catabolic process; hyaluronan biosynthetic process; lipopolysaccharide-mediated signaling pathway; protein kinase B signaling cascade; regulation of I-kappaB kinase/NF-kappaB cascade; inflammatory response; cytokine and chemokine mediated signaling pathway; MAPKKK cascade; response to ATP; positive regulation of interferon-gamma production; positive regulation of chemokine biosynthetic process; positive regulation of prostaglandin secretion; positive regulation of fever; positive regulation of histone acetylation; immune response; positive regulation of protein amino acid phosphorylation; regulation of insulin secretion; embryo implantation

Disease: Gastric Cancer, Hereditary Diffuse

Research Articles on IL1B

Similar Products

Product Notes

The IL1B il1b (Catalog #AAA953788) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 117-269. Full Length of Mature Protein. The amino acid sequence is listed below: APVRSLNCTL RDSQQKSLVM SGPYELKALH LQGQDMEQQV VFSMSFVQGE ESNDKIPVAL GLKEKNLYLS CVLKDDKPTL QLESVDPKNY PKKKMEKRFV FNKIEINNKL EFESAQFPNW YISTSQAENM PVFLGGTKGG QDITDFTMQF VSS. It is sometimes possible for the material contained within the vial of "Interleukin-1 beta (IL1B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.