SDS-PAGE
Interleukin-18 Recombinant Protein | Il18 recombinant protein
Recombinant Rat Interleukin-18 protein
Gene Names
Il18; IL-18
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-18; Recombinant Rat Interleukin-18 protein; Interferon gamma-inducing factor; IFN-gamma-inducing factorInterleukin-1 gamma; IL-1 gamma; Il18 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
37-194aa; Full Length
Sequence
HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS
Sequence Length
194
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Il18 recombinant protein
Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.
References
Induction of interferon-gamma inducing factor in the adrenal cortex.Conti B., Jahng J.W., Tinti C., Son J.H., Joh T.H.J. Biol. Chem. 272:2035-2037(1997)
Cloning of rat brain interleukin-18 cDNA.Culhane A.C., Hall M.D., Rothwell N.J., Luheshi G.N.Mol. Psychiatry 3:362-366(1998)
Cloning of the cDNA for interleukin-18 in PC12 and expression in Escherichia coli.Kim S.-J., Kim C.-S., Song K.-Y., Kim J.-S., Jung K.-S. IL-18 translational inhibition restricts IFN-gamma expression in crescentic glomerulonephritis.Garcia G.E., Xia Y., Ku G., Johnson R.J., Wilson C.B., Feng L.Kidney Int. 64:160-169(2003)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22.3 kDa
NCBI Official Full Name
interleukin-18
NCBI Official Synonym Full Names
interleukin 18
NCBI Official Symbol
Il18
NCBI Official Synonym Symbols
IL-18
NCBI Protein Information
interleukin-18
UniProt Protein Name
Interleukin-18
Protein Family
UniProt Gene Name
Il18
UniProt Synonym Gene Names
Igif; IL-18; IFN-gamma-inducing factor; IL-1 gamma
UniProt Entry Name
IL18_RAT
NCBI Description
a pro-inflammatory cytokine; acts as a modulator of immune functions [RGD, Feb 2006]
Uniprot Description
Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.
Research Articles on Il18
Similar Products
Product Notes
The Il18 il18 (Catalog #AAA1265525) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 37-194aa; Full Length. The amino acid sequence is listed below: HFGRLHCTTA VIRSINDQVL FVDKRNPPVF EDMPDIDRTA NESQTRLIIY MYKDSEVRGL AVTLSVKDGR MSTLSCKNKI ISFEEMNPPE NIDDIKSDLI FFQKRVPGHN KMEFESSLYE GHFLACQKED DAFKLVLKRK DENGDKSVMF TLTNLHQS. It is sometimes possible for the material contained within the vial of "Interleukin-18, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
