interleukin-17A (IL17A) Recombinant Protein | Il17a recombinant protein
Recombinant rat interleukin-17A (IL17A)
Gene Names
Il17a; Il17; IL-17; CTLA-8; IL-17A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
interleukin-17A (IL17A); Recombinant rat interleukin-17A (IL17A); Recombinant interleukin-17A (IL17A); Interleukin-17A; IL-17; IL-17A; Cytotoxic T-lymphocyte-associated antigen 8; CTLA-8; Il17a recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
18-150
Sequence
AVLIPQSSVCPNAEANNFLQNVKVNLKVINSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS
Sequence Length
150
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
16,877 Da
NCBI Official Full Name
Interleukin-17A
NCBI Official Synonym Full Names
interleukin 17A
NCBI Official Symbol
Il17a
NCBI Official Synonym Symbols
Il17; IL-17; CTLA-8; IL-17A
NCBI Protein Information
interleukin-17A; cytotoxic T-lymphocyte-associated antigen 8; Interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8)
UniProt Protein Name
Interleukin-17A
Protein Family
UniProt Gene Name
Il17a
UniProt Synonym Gene Names
Ctla8; Il17; IL-17; IL-17A; CTLA-8
UniProt Entry Name
IL17_RAT
NCBI Description
cytokine; may be involved in immune system function or to cell death and cell survival [RGD, Feb 2006]
Uniprot Description
Function: Induces stromal cells to produce proinflammatory and hematopoietic cytokines
By similarity.
Subunit structure: Homodimer
By similarity.
Subcellular location: Secreted.
Sequence similarities: Belongs to the IL-17 family.
Caution: Was originally (Ref.1) thought to be from mouse but, on the basis of subsequent work (Ref.2 and Ref.3) has been shown to be of rat origin.
Research Articles on Il17a
Similar Products
Product Notes
The Il17a il17a (Catalog #AAA1253911) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-150. The amino acid sequence is listed below: AVLIPQSSVC PNAEANNFLQ NVKVNLKVIN SLSSKASSRR PSDYLNRSTS PWTLSRNEDP DRYPSVIWEA QCRHQRCVNA EGKLDHHMNS VLIQQEILVL KREPEKCPFT FRVEKMLVGV GCTCVSSIVR HAS. It is sometimes possible for the material contained within the vial of "interleukin-17A (IL17A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
