(Rhesus macaque) Interleukin-12 subunit alpha (IL12A) Recombinant Protein | IL12A recombinant protein
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-12 subunit alpha (IL12A)
Gene Names
IL12A; IL-12A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
(Rhesus macaque) Interleukin-12 subunit alpha (IL12A); Recombinant Macaca mulatta (Rhesus macaque) Interleukin-12 subunit alpha (IL12A); Recombinant (Rhesus macaque) Interleukin-12 subunit alpha (IL12A); Interleukin-12 subunit alpha; IL-12A; Cytotoxic lymphocyte maturation factor 35 kDa subunit; CLMF p35 IL-12 subunit p35; IL12A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-219
Sequence
RNLSVATPGPEMFPCLHHSQNLLKAASNTLQKARQILEFYPCTSEEIDHEDITKDKTSTVEACLPLELIKNESCLNSRETSFITNGSCLASRKTSFMMALCLRSIYEDLKMYQVEFKTMNAKLLRDPKRQIFLDQNILGVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Sequence Length
219
Species
Macaca mulatta (Rhesus macaque)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,904 Da
NCBI Official Full Name
interleukin-12 subunit alpha
NCBI Official Symbol
IL12A
NCBI Official Synonym Symbols
IL-12A
NCBI Protein Information
interleukin-12 subunit alpha; CLMF p35; IL-12 subunit p35; cytotoxic lymphocyte maturation factor 35 kDa subunit
UniProt Protein Name
Interleukin-12 subunit alpha
Protein Family
UniProt Gene Name
IL12A
UniProt Synonym Gene Names
IL-12A; CLMF p35
UniProt Entry Name
IL12A_MACMU
Uniprot Description
Function: Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC
By similarity.
Subunit structure: Heterodimer with IL12B; disulfide-linked. The heterodimer is known as interleukin IL-12
By similarity.
Subcellular location: Secreted.
Sequence similarities: Belongs to the IL-6 superfamily.
Sequence caution: The sequence AAA86707.1 differs from that shown. Reason: Erroneous initiation.
Similar Products
Product Notes
The IL12A il12a (Catalog #AAA955174) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-219. The amino acid sequence is listed below: RNLSVATPGP EMFPCLHHSQ NLLKAASNTL QKARQILEFY PCTSEEIDHE DITKDKTSTV EACLPLELIK NESCLNSRET SFITNGSCLA SRKTSFMMAL CLRSIYEDLK MYQVEFKTMN AKLLRDPKRQ IFLDQNILGV IDELMQALNF NSETVPQKSS LEEPDFYKTK IKLCILLHAF RIRAVTIDRV MSYLNAS. It is sometimes possible for the material contained within the vial of "(Rhesus macaque) Interleukin-12 subunit alpha (IL12A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
