Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interleukin-12 subunit alpha (IL12A) Recombinant Protein | IL12A recombinant protein

Recombinant Bovine Interleukin-12 subunit alpha (IL12A)

Gene Names
IL12A; IL12p35; Il-12 p35
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-12 subunit alpha (IL12A); Recombinant Bovine Interleukin-12 subunit alpha (IL12A); IL12A recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-221, Full length protein
Sequence
RSLPTTTASPGRSCLDYSQNLLRAVSNTLQKARQTLEFYSCTSEEIDHEDITKDKTSTVEACLPLELATNESCLASRETSFITNGHCLASGKTSFMTTLCLRSIYEDLKMYHVEFQAMNAKLLMDPKRQIFLDQNMLAAIAELMQALNFDSETVPQKPSLKELDFYKTKVKLCILLHAFRIRAVTIDRMMSYLSSS
Sequence Length
196
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for IL12A recombinant protein
This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A
NOS2) is found to be required for the signaling process of this cytokine in innate immunity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,944 Da
NCBI Official Full Name
interleukin-12 subunit alpha
NCBI Official Synonym Full Names
interleukin 12A
NCBI Official Symbol
IL12A
NCBI Official Synonym Symbols
IL12p35; Il-12 p35
NCBI Protein Information
interleukin-12 subunit alpha
UniProt Protein Name
Interleukin-12 subunit alpha
Protein Family
UniProt Gene Name
IL12A
UniProt Synonym Gene Names
IL-12A; CLMF p35

Uniprot Description

Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC.

Research Articles on IL12A

Similar Products

Product Notes

The IL12A il12a (Catalog #AAA948979) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-221, Full length protein. The amino acid sequence is listed below: RSLPTTTASP GRSCLDYSQN LLRAVSNTLQ KARQTLEFYS CTSEEIDHED ITKDKTSTVE ACLPLELATN ESCLASRETS FITNGHCLAS GKTSFMTTLC LRSIYEDLKM YHVEFQAMNA KLLMDPKRQI FLDQNMLAAI AELMQALNFD SETVPQKPSL KELDFYKTKV KLCILLHAFR IRAVTIDRMM SYLSSS. It is sometimes possible for the material contained within the vial of "Interleukin-12 subunit alpha (IL12A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.