Replication-associated protein G2P (II) Recombinant Protein | II recombinant protein
Recombinant Enterobacteria phage I2-2 Replication-associated protein G2P (II)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Replication-associated protein G2P (II); Recombinant Enterobacteria phage I2-2 Replication-associated protein G2P (II); II recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-344, Full length protein
Sequence
MIDWVTAVLPCLHVPVDAGRVLSVAPDGSVEWESVKFSRVTGSFQSSISVRSQGSDGNGKATHLYVDGNPSKWLQGHNIVGSDDLNGLMIAFYARMLSLLNIPHHLESYRQVLSGQYELKRVDINYMFELPTLIDVRSWLHAAEFKAKTRHGRPATAKGTLYFGKNSRRWSIKAYSKYDEVNCGKKAHGVPEEIKKTGLVEWSKNKLRLELTLRALQLTDINLNFAKNWSTETAYTVFKEYMGRIEMSGNTLLTDTQVINLPSALRMTYVCWKQGICVTDMVSRATYFRHRKVLKEFGIDIAVTVDRVDNSNVVPLIRVLEAKPASIPSQYDNLIFSSNRVSSF
Sequence Length
344
Species
Enterobacteria phage I2-2 (Bacteriophage I2-2)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,024 Da
NCBI Official Full Name
gene II product
NCBI Official Symbol
I2-2p3
NCBI Protein Information
replication initiation protein
UniProt Protein Name
Replication-associated protein G2P
UniProt Gene Name
II
UniProt Synonym Gene Names
Rep
Uniprot Description
Isoform G2P plays an essential role in viral DNA replication. Binds the origin of replication and cleaves the dsDNA replicative form I (RFI) and becomes covalently bound to it via phosphotyrosine bond, generating the dsDNA replicative form II (RFII). In turn, viral DNA replication initiates at the 3'-OH of the cleavage site. After one round of rolling circle synthesis, protein G2P is linked to the newly synthesized ssDNA and joins the ends of the displaced strand to generate a circular single-stranded molecule ready to be packed into a virion.
Similar Products
Product Notes
The II ii (Catalog #AAA1194136) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-344, Full length protein. The amino acid sequence is listed below: MIDWVTAVLP CLHVPVDAGR VLSVAPDGSV EWESVKFSRV TGSFQSSISV RSQGSDGNGK ATHLYVDGNP SKWLQGHNIV GSDDLNGLMI AFYARMLSLL NIPHHLESYR QVLSGQYELK RVDINYMFEL PTLIDVRSWL HAAEFKAKTR HGRPATAKGT LYFGKNSRRW SIKAYSKYDE VNCGKKAHGV PEEIKKTGLV EWSKNKLRLE LTLRALQLTD INLNFAKNWS TETAYTVFKE YMGRIEMSGN TLLTDTQVIN LPSALRMTYV CWKQGICVTD MVSRATYFRH RKVLKEFGID IAVTVDRVDN SNVVPLIRVL EAKPASIPSQ YDNLIFSSNR VSSF. It is sometimes possible for the material contained within the vial of "Replication-associated protein G2P (II), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
