SDS-PAGE
Sorting nexin-24 Recombinant Protein | SNX24 recombinant protein
Recombinant Human Sorting nexin-24
Gene Names
SNX24; SBBI31; PRO1284
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sorting nexin-24; Recombinant Human Sorting nexin-24; SNX24 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-169aa; Full Length
Sequence
MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLRDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR
Sequence Length
169
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for SNX24 recombinant protein
May be involved in several stages of intracellular trafficking.
Product Categories/Family for SNX24 recombinant protein
References
Hypothetical human protein SBBI31.Zhang W., Wan T., Cao X.SBBI31 as a new member (SNX24)
of the sorting nexin family.Hong W.The secreted protein discovery initiative (SPDI)
, a large-scale effort to identify novel human secreted and transmembrane proteins
a bioinformatics assessment.Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.Genome Res. 13:2265-2270(2003)
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.Anal. Chem. 81:4493-4501(2009)
N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35.8 kDa
NCBI Official Full Name
sorting nexin-24
NCBI Official Synonym Full Names
sorting nexin 24
NCBI Official Symbol
SNX24
NCBI Official Synonym Symbols
SBBI31; PRO1284
NCBI Protein Information
sorting nexin-24
UniProt Protein Name
Sorting nexin-24
Protein Family
UniProt Gene Name
SNX24
UniProt Entry Name
SNX24_HUMAN
Uniprot Description
SNX24: May be involved in several stages of intracellular trafficking. Belongs to the sorting nexin family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Vesicle
Chromosomal Location of Human Ortholog: 5q23.2
Cellular Component: cytoplasmic vesicle membrane
Molecular Function: phosphatidylinositol 3-phosphate binding; phosphatidylinositol-5-phosphate binding
Biological Process: protein transport
Similar Products
Product Notes
The SNX24 snx24 (Catalog #AAA969613) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-169aa; Full Length. The amino acid sequence is listed below: MEVYIPSFRY EESDLERGYT VFKIEVLMNG RKHFVEKRYS EFHALHKKLK KCIKTPEIPS KHVRNWVPKV LEQRRQGLET YLQAVILENE ELPKLFLDFL NVRHLPSLPK AESCGSFDET ESEESSKLSH QPVLLFLRDP YVLPAASDFP NVVIEGVLHG IFYPHLQPR. It is sometimes possible for the material contained within the vial of "Sorting nexin-24, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
