Cation-independent mannose-6-phosphate receptor (IGF2R) Recombinant Protein | IGF2R recombinant protein
Recombinant Bovine Cation-independent mannose-6-phosphate receptor (IGF2R) , partial
Gene Names
IGF2R; CIMPR; CI-MPR
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cation-independent mannose-6-phosphate receptor (IGF2R); Recombinant Bovine Cation-independent mannose-6-phosphate receptor (IGF2R); partial; IGF2R recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
628-772aa; Partial
Sequence
LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for IGF2R recombinant protein
This protein is a receptor for both, insulin-like growth factor 2 (IGF2) and mannose 6-phosphate (M6P). The IGF2 and M6P binding sites are located on different segments of the receptor. This receptor functions in the intracellular trafficking of lysosomal enzymes, the activation of transforming growth factor beta, and the degradation of IGF2. In mice, the homologous gene is expressed only from the maternal chromosome.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
274,529 Da
NCBI Official Full Name
cation-independent mannose-6-phosphate receptor
NCBI Official Synonym Full Names
insulin like growth factor 2 receptor
NCBI Official Symbol
IGF2R
NCBI Official Synonym Symbols
CIMPR; CI-MPR
NCBI Protein Information
cation-independent mannose-6-phosphate receptor
UniProt Protein Name
Cation-independent mannose-6-phosphate receptor
Protein Family
UniProt Gene Name
IGF2R
UniProt Synonym Gene Names
M6P; CI Man-6-P receptor; CI-MPR; M6PR; MPR 300; IGF-II receptor
Uniprot Description
Acts as a positive regulator of T-cell coactivation, by binding DPP4 (). Transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelyosomal compartment where the low pH mediates the dissociation of the complex. This receptor also binds IGF2.
Research Articles on IGF2R
Similar Products
Product Notes
The IGF2R igf2r (Catalog #AAA953345) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 628-772aa; Partial. The amino acid sequence is listed below: LSRTEGDNCT VFDSQAGFSF DLTPLTKKDA YKVETDKYEF HINVCGPVSV GACPPDSGAC QVSRSDRKSW NLGRSNAKLS YYDGMIQLTY RDGTPYNNEK RTPRATLITF LCDRDAGVGF PEYQEEDNST YNFRWYTSYA CPEEP . It is sometimes possible for the material contained within the vial of "Cation-independent mannose-6-phosphate receptor (IGF2R), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
