Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interleukin-28 receptor subunit alpha (IFNLR1) Recombinant Protein | IFNLR1 recombinant protein

Recombinant Human Interleukin-28 receptor subunit alpha (IFNLR1), partial

Gene Names
IFNLR1; IFNLR; LICR2; IL28RA; CRF2/12; IL-28R1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-28 receptor subunit alpha (IFNLR1); Recombinant Human Interleukin-28 receptor subunit alpha (IFNLR1); partial; Interferon lambda receptor 1(IFN-lambda receptor 1)(IFN-lambda-R1)(Cytokine receptor class-II member 12)(Cytokine receptor family 2 member 12)(CRF2-12)(Interleukin-28 receptor subunit alpha)(IL-28 receptor subunit alpha)(IL-28R-alpha)(IL-28RA)(Likely interleukin or cytokine receptor 2)(LICR2); IFNLR1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-228aa, Partial
Sequence
RPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWA
Species
Homo sapiens (Human)
Relevance
The IFNLR1/IL10RB dimer is a receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity. The ligand/receptor complex stimulate the activation of the JAK/STAT signaling pathway leading to the expression of IFN-stimulated genes (ISG), which contribute to the antiviral state. Determines the cell type specificity of the lambda interferon action. Shows a more restricted pattern of expression in the epithelial tissues thereby limiting responses to lambda interferons primarily to epithelial cells of the respiratory, gastrointestinal, and reproductive tracts. Seems not to be essential for early virus-activated host defense in vaginal infection, but plays an important role in Toll-like receptor (TLR)-induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Product Categories/Family for IFNLR1 recombinant protein
References
"IFN-lambdas mediate antiviral protection through a distinct class II cytokine receptor complex."Kotenko S.V., Gallagher G., Baurin V.V., Lewis-Antes A., Shen M., Shah N.K., Langer J.A., Sheikh F., Dickensheets H., Donnelly R.P.Nat. Immunol. 4:69-77(2003)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
57,653 Da
NCBI Official Full Name
Interferon lambda receptor 1
NCBI Official Synonym Full Names
interferon, lambda receptor 1
NCBI Official Symbol
IFNLR1
NCBI Official Synonym Symbols
IFNLR; LICR2; IL28RA; CRF2/12; IL-28R1
NCBI Protein Information
interferon lambda receptor 1; CRF2-12; IL-28RA; IL-28R-alpha; IFN-lambda-R1; IFN-lambda receptor 1; interleukin 28 receptor A; IL-28 receptor subunit alpha; interferon lambda, receptor 1; interleukin 28 alpha receptor; class II cytokine receptor CRF2/12;
UniProt Protein Name
Interferon lambda receptor 1
UniProt Gene Name
IFNLR1
UniProt Synonym Gene Names
IL28RA; LICR2; IFN-lambda receptor 1; IFN-lambda-R1; CRF2-12; IL-28 receptor subunit alpha; IL-28R-alpha; IL-28RA; LICR2
UniProt Entry Name
INLR1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

IL28RA: The IL28RA/IL10RB dimer is a receptor for IL28A, IL28B and IL29. The ligand/receptor complex seems to signal through the Jak-STAT pathway. Belongs to the type II cytokine receptor family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p36.11

Cellular Component: integral to membrane; interleukin-28 receptor complex

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; protein binding

Biological Process: negative regulation of cell proliferation; mucosal immune response; cytokine and chemokine mediated signaling pathway; regulation of defense response to virus by host; defense response to virus

Research Articles on IFNLR1

Similar Products

Product Notes

The IFNLR1 ifnlr1 (Catalog #AAA9018605) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-228aa, Partial. The amino acid sequence is listed below: RPRLAPPQNV TLLSQNFSVY LTWLPGLGNP QDVTYFVAYQ SSPTRRRWRE VEECAGTKEL LCSMMCLKKQ DLYNKFKGRV RTVSPSSKSP WVESEYLDYL FEVEPAPPVL VLTQTEEILS ANATYQLPPC MPPLDLKYEV AFWKEGAGNK TLFPVTPHGQ PVQITLQPAA SEHHCLSART IYTFSVPKYS KFSKPTCFLL EVPEANWA. It is sometimes possible for the material contained within the vial of "Interleukin-28 receptor subunit alpha (IFNLR1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.