Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human IL-29 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 27-37 kDa.)

IL-29 recombinant protein

Recombinant Human IL-29 Protein

Gene Names
IFNL1; IL29; IL-29
Purity
>95% by SDS-PAGE.
Synonyms
IL-29; Recombinant Human IL-29 Protein; IFNL1; IL29; IL-29 recombinant protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
Sequence Length
200
Species
Human
Endotoxin
Please contact us for more information.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human IL-29 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 27-37 kDa.)

SDS-Page (Recombinant Human IL-29 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 27-37 kDa.)
Related Product Information for IL-29 recombinant protein
Description: Recombinant Human IL-29 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gly20-Thr200) of human IL-29 (Accession #NP_742152.1) fused with a 6xHis tag at the C-terminus.

Background: This protein is also known as cytokine Zcyto21, Interferon lambda-1, IFN-lambda-1, and IFNL1, is a secreted protein which belongs to the IL-28 / IL-29 family. IL-29 is a cytokine with immunomodulatory activity. IL-29 is highly similar in amino acid sequence to the IL-28. IL-28 and IL-29 are induced by viral infection and showed antiviral activity. IL-28 and IL-29 interacted with a heterodimeric class II cytokine receptor that consisted of IL-1 receptor beta (IL-1Rbeta) and an orphan class II receptor chain, designated IL-28Ralpha. IL-29 plays an important role in host defenses against microbes and its gene is highly upregulated in cells infected with viruses. IL-29 may play a role in antiviral immunity. IL-29 up-regulates MHC class I antigen expression. It is a Ligand for the heterodimeric class II cytokine receptor composed of IL1RB and IL28RA. The ligand / receptor complex seems to signal through the Jak-STAT pathway.
Product Categories/Family for IL-29 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interferon lambda-1
NCBI Official Synonym Full Names
interferon lambda 1
NCBI Official Symbol
IFNL1
NCBI Official Synonym Symbols
IL29; IL-29
NCBI Protein Information
interferon lambda-1
UniProt Protein Name
Interferon lambda-1
UniProt Gene Name
IFNL1
UniProt Synonym Gene Names
IL29; ZCYTO21; IFN-lambda-1; IL-29
UniProt Entry Name
IFNL1_HUMAN

NCBI Description

This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). [provided by RefSeq, Jul 2008]

Uniprot Description

IL29: Cytokine with immunomodulatory activity. May play a role in antiviral immunity. Up-regulates MHC class I antigen expression. Ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway. Belongs to the IL-28/IL-29 family.

Protein type: Cytokine; Secreted, signal peptide; Secreted; Cell cycle regulation

Chromosomal Location of Human Ortholog: 19q13.13

Cellular Component: extracellular space; extracellular region; interleukin-28 receptor complex

Molecular Function: cytokine activity; interleukin-28 receptor binding; receptor binding

Biological Process: positive regulation of immune response; positive regulation of transcription, DNA-dependent; positive regulation of JAK-STAT cascade; JAK-STAT cascade; negative regulation of T cell differentiation; negative regulation of cell proliferation; positive regulation of interferon-gamma production; negative regulation of interleukin-13 production; positive regulation of tyrosine phosphorylation of STAT protein; negative regulation of T-helper 2 type immune response; negative regulation of interleukin-5 production; positive regulation of MHC class I biosynthetic process; negative regulation of transcription, DNA-dependent; negative regulation of memory T cell differentiation; defense response to virus

Research Articles on IL-29

Similar Products

Product Notes

The IL-29 ifnl1 (Catalog #AAA9141842) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: GPVPTSKPTT TGKGCHIGRF KSLSPQELAS FKKARDALEE SLKLKNWSCS SPVFPGNWDL RLLQVRERPV ALEAELALTL KVLEAAAGPA LEDVLDQPLH TLHHILSQLQ ACIQPQPTAG PRPRGRLHHW LHRLQEAPKK ESAGCLEASV TFNLFRLLTR DLKYVADGNL CLRTSTHPES T. It is sometimes possible for the material contained within the vial of "IL-29, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.