SDS-PAGE
Interferon epsilon Recombinant Protein | Ifne recombinant protein
Recombinant Mouse Interferon epsilon
Gene Names
Ifne; Ifne1; Ifnt1; Infe1; Ifn-tau-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interferon epsilon; Recombinant Mouse Interferon epsilon; Interferon epsilon-1Interferon tau-1; Ifne recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-192aa; Full Length
Sequence
LEPKRIPFQLWMNRESLQLLKPLPSSSVQQCLAHRKNFLLPQQPVSPHQYQEGQVLAVVHEILQQIFTLLQTHGTMGIWEENHIEKVLAALHRQLEYVESLGGLNAAQKSGGSSAQNLRLQIKAYFRRIHDYLENQRYSSCAWIIVQTEIHRCMFFVFRFTTWLSRQDPDP
Sequence Length
192
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Ifne recombinant protein
Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the fale reproductive tract. Directly mediates protection against viral, including HSV-2, and bacterial, including Chlamydia muridarum, genital infections.
References
Characterization of the type I interferon locus and identification of novel genes.Hardy M.P., Owczarek C.M., Jermiin L.S., Ejdebaeck M., Hertzog P.J.Genomics 84:331-345(2004)
Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009)
Interferon-epsilon protects the female reproductive tract from viral and bacterial infection.Fung K.Y., Mangan N.E., Cumming H., Horvat J.C., Mayall J.R., Stifter S.A., De Weerd N., Roisman L.C., Rossjohn J., Robertson S.A., Schjenken J.E., Parker B., Gargett C.E., Nguyen H.P., Carr D.J., Hansbro P.M., Hertzog P.J.Science 339:1088-1092(2013)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22 kDa
NCBI Official Full Name
interferon epsilon
NCBI Official Synonym Full Names
interferon epsilon
NCBI Official Symbol
Ifne
NCBI Official Synonym Symbols
Ifne1; Ifnt1; Infe1; Ifn-tau-1
NCBI Protein Information
interferon epsilon
UniProt Protein Name
Interferon epsilon
Protein Family
UniProt Gene Name
Ifne
UniProt Synonym Gene Names
Ifne1; Ifnt1; IFN-epsilon
UniProt Entry Name
IFNE_MOUSE
Uniprot Description
IFNE1: Belongs to the alpha/beta interferon family.
Protein type: Secreted; Secreted, signal peptide
Cellular Component: extracellular region; extracellular space
Molecular Function: cytokine activity; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; interferon-alpha/beta receptor binding
Biological Process: adaptive immune response; B cell differentiation; B cell proliferation; cytokine and chemokine mediated signaling pathway; defense response; defense response to bacterium; defense response to virus; humoral immune response; natural killer cell activation during immune response; positive regulation of peptidyl-serine phosphorylation of STAT protein; response to exogenous dsRNA; T cell activation during immune response
Research Articles on Ifne
Similar Products
Product Notes
The Ifne ifne (Catalog #AAA1425730) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-192aa; Full Length. The amino acid sequence is listed below: LEPKRIPFQL WMNRESLQLL KPLPSSSVQQ CLAHRKNFLL PQQPVSPHQY QEGQVLAVVH EILQQIFTLL QTHGTMGIWE ENHIEKVLAA LHRQLEYVES LGGLNAAQKS GGSSAQNLRL QIKAYFRRIH DYLENQRYSS CAWIIVQTEI HRCMFFVFRF TTWLSRQDPD P. It is sometimes possible for the material contained within the vial of "Interferon epsilon, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
