Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interferon-induced transmembrane protein 5 (IFITM5) Recombinant Protein | IFITM5 recombinant protein

Recombinant Human Interferon-induced transmembrane protein 5 (IFITM5)

Gene Names
IFITM5; OI5; BRIL; DSPA1; Hrmp1; fragilis4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interferon-induced transmembrane protein 5 (IFITM5); Recombinant Human Interferon-induced transmembrane protein 5 (IFITM5); Recombinant Interferon-induced transmembrane protein 5 (IFITM5); Interferon-induced transmembrane protein 5; Bone-restricted interferon-induced transmembrane protein-like protein; BRIL; IFITM5 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-132
Sequence
MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYSIKARDQKVVGDLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAAFFSTKFDDADYD
Sequence Length
132
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,378 Da
NCBI Official Full Name
interferon-induced transmembrane protein 5
NCBI Official Synonym Full Names
interferon induced transmembrane protein 5
NCBI Official Symbol
IFITM5
NCBI Official Synonym Symbols
OI5; BRIL; DSPA1; Hrmp1; fragilis4
NCBI Protein Information
interferon-induced transmembrane protein 5; dispanin subfamily A member 1; bone-restricted ifitm-like protein; bone-restricted interferon-induced transmembrane protein-like protein
UniProt Protein Name
Interferon-induced transmembrane protein 5
UniProt Gene Name
IFITM5
UniProt Synonym Gene Names
BRIL; DSPA1
UniProt Entry Name
IFM5_HUMAN

NCBI Description

This gene encodes a membrane protein thought to play a role in bone mineralization. This gene is located on chromosome 11 in a cluster of related genes which are induced by interferon, however, this gene has not been shown to be interferon inducible. A similar gene, located in a gene cluster on mouse chromosome 7, is a member of the interferon-inducible fragilis gene family. The mouse gene encodes a transmembrane protein described as participating in germ cell competence. A mutation in the 5' UTR of this gene has been associated with osteogenesis imperfecta type V (PMID: 22863190, 22863195). [provided by RefSeq, Aug 2012]

Uniprot Description

IFITM5: Plays a role in bone mineralization. Belongs to the CD225/Dispanin family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: integral to plasma membrane

Biological Process: response to biotic stimulus; regulation of bone mineralization; bone mineralization

Disease: Osteogenesis Imperfecta, Type V

Research Articles on IFITM5

Similar Products

Product Notes

The IFITM5 ifitm5 (Catalog #AAA1239360) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-132. The amino acid sequence is listed below: MDTAYPREDT RAPTPSKAGA HTALTLGAPH PPPRDHLIWS VFSTLYLNLC CLGFLALAYS IKARDQKVVG DLEAARRFGS KAKCYNILAA MWTLVPPLLL LGLVVTGALH LARLAKDSAA FFSTKFDDAD YD. It is sometimes possible for the material contained within the vial of "Interferon-induced transmembrane protein 5 (IFITM5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.