Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immediate early response 3-interacting protein 1 (Ier3ip1) Recombinant Protein | Ier3ip1 recombinant protein

Recombinant Mouse Immediate early response 3-interacting protein 1 (Ier3ip1)

Gene Names
Ier3ip1; AI644142; AL022842; AL022863; AV026606; 1110057H19Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Immediate early response 3-interacting protein 1 (Ier3ip1); Recombinant Mouse Immediate early response 3-interacting protein 1 (Ier3ip1); Ier3ip1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-82aa; full length protein
Sequence
MAFTLYSLMQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVR TVMRVPLIIVNSITIVLLLLFG
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Ier3ip1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9,017 Da
NCBI Official Full Name
immediate early response 3-interacting protein 1
NCBI Official Synonym Full Names
immediate early response 3 interacting protein 1
NCBI Official Symbol
Ier3ip1
NCBI Official Synonym Symbols
AI644142; AL022842; AL022863; AV026606; 1110057H19Rik
NCBI Protein Information
immediate early response 3-interacting protein 1
UniProt Protein Name
Immediate early response 3-interacting protein 1
UniProt Gene Name
Ier3ip1
UniProt Entry Name
IR3IP_MOUSE

Uniprot Description

IER3IP1: May be implicated in the regulation of apoptosis. May be involved in protein transport between endoplasmic reticulum and Golgi apparatus. Defects in IER3IP1 are the cause of microcephaly epilepsy and diabetes syndrome (MEDS). An autosomal recessive disorder characterized by microcephaly, simplified gyral pattern, severe epilepsy, and infantile diabetes. Belongs to the YOS1 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Cellular Component: endoplasmic reticulum; Golgi apparatus; integral to membrane; membrane

Similar Products

Product Notes

The Ier3ip1 ier3ip1 (Catalog #AAA7017407) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-82aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Ier3ip1 ier3ip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAFTLYSLMQ AALLCVNAIA VLHEERFLKN IGWGTDQGIG GFGEEPGIKS QLMNLIRSVR TVMRVPLIIV NSITIVLLLL FG. It is sometimes possible for the material contained within the vial of "Immediate early response 3-interacting protein 1 (Ier3ip1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.