Radiation-inducible immediate-early gene IEX-1 Recombinant Protein | IER3 recombinant protein

Radiation-inducible immediate-early gene IEX-1

Cat. Num. AAA7042879

• Gene Names: IER3; DIF2; IEX1; PRG1; DIF-2; GLY96; IEX-1; IEX-1L
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Radiation-inducible immediate-early gene IEX-1; IER3 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-156aa; full length protein
• Sequence: MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRKRSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASLAPTPVSAVLEPFNLTSEPSDYALDLSTFLQQHPAAF
• Sequence Length: Full Length Protein

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for IER3 recombinant protein

This is a recombinant transmembrane protein expressed in a cell-free expression system.

Product Categories/Family for IER3 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 119964723
• NCBI GeneID: 8870
• NCBI Accession #: NP_003888.2
• NCBI GenBank Nucleotide #: NM_003897.3
• UniProt Accession #: P46695; Q5SU30; Q92691; Q93044
• Molecular Weight: 16,903 Da
• NCBI Official Full Name: radiation-inducible immediate-early gene IEX-1
• NCBI Official Synonym Full Names: immediate early response 3
• NCBI Official Symbol: IER3
• NCBI Official Synonym Symbols: DIF2; IEX1; PRG1; DIF-2; GLY96; IEX-1; IEX-1L
• NCBI Protein Information: radiation-inducible immediate-early gene IEX-1
• UniProt Protein Name: Radiation-inducible immediate-early gene IEX-1
• Protein Family: Radiation-inducible immediate-early gene
• UniProt Gene Name: IER3
• UniProt Synonym Gene Names: DIF2; IEX1; PRG1; Protein DIF-2; Protein PRG1
• UniProt Entry Name: IEX1_HUMAN

NCBI Description

This gene functions in the protection of cells from Fas- or tumor necrosis factor type alpha-induced apoptosis. Partially degraded and unspliced transcripts are found after virus infection in vitro, but these transcripts are not found in vivo and do not generate a valid protein. [provided by RefSeq, Jul 2008]

Uniprot Description

IEX-1: May play a role in the ERK signaling pathway by inhibiting the dephosphorylation of ERK by phosphatase PP2A- PPP2R5C holoenzyme. Acts also as an ERK downstream effector mediating survival. Belongs to the IER3 family.

Protein type: Apoptosis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: cytosol; nucleus

Molecular Function: protein binding

Biological Process: anatomical structure morphogenesis; apoptosis; regulation of phosphoinositide 3-kinase cascade