Isopentenyl-diphosphate Delta-isomerase 1 (Idi1) Recombinant Protein | Idi1 recombinant protein
Recombinant Mouse Isopentenyl-diphosphate Delta-isomerase 1 (Idi1)
Gene Names
Idi1; 4832416K17Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Isopentenyl-diphosphate Delta-isomerase 1 (Idi1); Recombinant Mouse Isopentenyl-diphosphate Delta-isomerase 1 (Idi1); Idi1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-227, Full length protein
Sequence
MPEINTSHLDEKQVQLLAEMCILIDENDNKIGADTKKNCHLNENIDKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNSCCSHPLSNPGELEENNAIGVKRAAKRRLKAELGIPLEEVDLNEMDYLTRIYYKAQSDGIWGEHEVDYILFLRKNVTLNPDPNEIKSYCYVSKEEVREILKKAASGEIKLTPWFKIIADTFLFKWWDNLNHLSPFVDHEKIHRL
Sequence Length
227
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Idi1 recombinant protein
IDI1 encodes a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in the synthesis of farnesyl diphosphate and, ultimately, cholesterol. It has been shown in peroxisomal deficiency diseases such as Zellweger syndrome and neonatal adrenoleukodystrophy that there is reduction in IPP isomerase activity.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26,289 Da
NCBI Official Full Name
isopentenyl-diphosphate Delta-isomerase 1
NCBI Official Synonym Full Names
isopentenyl-diphosphate delta isomerase
NCBI Official Symbol
Idi1
NCBI Official Synonym Symbols
4832416K17Rik
NCBI Protein Information
isopentenyl-diphosphate Delta-isomerase 1
UniProt Protein Name
Isopentenyl-diphosphate Delta-isomerase 1
Protein Family
UniProt Gene Name
Idi1
UniProt Synonym Gene Names
IPP isomerase 1; IPPI1
Uniprot Description
Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP).
Research Articles on Idi1
Similar Products
Product Notes
The Idi1 idi1 (Catalog #AAA947966) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-227, Full length protein. The amino acid sequence is listed below: MPEINTSHLD EKQVQLLAEM CILIDENDNK IGADTKKNCH LNENIDKGLL HRAFSVFLFN TENKLLLQQR SDAKITFPGC FTNSCCSHPL SNPGELEENN AIGVKRAAKR RLKAELGIPL EEVDLNEMDY LTRIYYKAQS DGIWGEHEVD YILFLRKNVT LNPDPNEIKS YCYVSKEEVR EILKKAASGE IKLTPWFKII ADTFLFKWWD NLNHLSPFVD HEKIHRL. It is sometimes possible for the material contained within the vial of "Isopentenyl-diphosphate Delta-isomerase 1 (Idi1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
