Outer membrane protein IcsA autotransporter (icsA) Recombinant Protein | icsA recombinant protein
Recombinant Shigella flexneri Outer membrane protein IcsA autotransporter (icsA), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Outer membrane protein IcsA autotransporter (icsA); Recombinant Shigella flexneri Outer membrane protein IcsA autotransporter (icsA); partial; icsA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
419-758aa; Partial
Sequence
FGNNVKVEAIINNWAQKDYKLLSADKGITGFSVSNISIINPLLTTGAIDYTKSYISDQNKLIYGLSWNDTDGDSHGEFNLKENAELTVSTILADNLSHHNINSWDGKSLTKSGEGTLILAEKNTYSGFTNINAGILKMGTVEAMTRTAGVIVNKGATLNFSGMNQTVNTLLNSGTVLINNINAPFLPDPVIVTGNMTLEKNGHVILNNSSSNVGQTYVQKGNWHGKGGILSLGAVLGNDNSKTDRLEIAGHASGITYVAVTNEGGSGDKTLEGVQIISTDSSDKNAFIQKGRIVAGSYDYRLKQGTVSGLNTNKWYLTSQMDNQESKQMSNQESTQMSSR
Species
Shigella flexneri
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
116,244 Da
NCBI Official Full Name
hypothetical protein CP0182 (plasmid)
NCBI Official Symbol
icsA/virG
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Outer membrane protein IcsA autotransporter
Protein Family
UniProt Gene Name
icsA
UniProt Synonym Gene Names
virG
Uniprot Description
Essential for bacterial spreading by eliciting polar deposition of filamentous actin (actin-based motility). Inside the host cell mediates nucleation and polymerization of actin molecules on the bacterial surface, which provides the propulsive force for intracellular movement and intercellular dissemination of the bacterium. During invasion of mammalian cells, triggers autophagy by binding to APG5L. Interaction with IcsB leads to escape from the autophagic host defense system. Also binds ATP and displays weak ATPase activity.
Research Articles on icsA
Similar Products
Product Notes
The icsA icsa (Catalog #AAA7087956) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 419-758aa; Partial. The amino acid sequence is listed below: FGNNVKVEAI INNWAQKDYK LLSADKGITG FSVSNISIIN PLLTTGAIDY TKSYISDQNK LIYGLSWNDT DGDSHGEFNL KENAELTVST ILADNLSHHN INSWDGKSLT KSGEGTLILA EKNTYSGFTN INAGILKMGT VEAMTRTAGV IVNKGATLNF SGMNQTVNTL LNSGTVLINN INAPFLPDPV IVTGNMTLEK NGHVILNNSS SNVGQTYVQK GNWHGKGGIL SLGAVLGNDN SKTDRLEIAG HASGITYVAV TNEGGSGDKT LEGVQIISTD SSDKNAFIQK GRIVAGSYDY RLKQGTVSGL NTNKWYLTSQ MDNQESKQMS NQESTQMSSR . It is sometimes possible for the material contained within the vial of "Outer membrane protein IcsA autotransporter (icsA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
