Auxin-responsive protein IAA18 (IAA18) Recombinant Protein | IAA18 recombinant protein
Recombinant Arabidopsis thaliana Auxin-responsive protein IAA18 (IAA18)
Gene Names
IAA18; indole-3-acetic acid inducible 18; T14L22.14; T14L22_14
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Auxin-responsive protein IAA18 (IAA18); Recombinant Arabidopsis thaliana Auxin-responsive protein IAA18 (IAA18); IAA18 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-267, Full length protein
Sequence
MEGYSRNGEISPKLLDLMIPQERRNWFHDEKNSVFKTEEKKLELKLGPPGEEDDDESMIRHMKKEPKDKSILSLAGKYFSPSSTKTTSHKRTAPGPVVGWPPVRSFRKNLASGSSSKLGNDSTTSNGVTLKNQKCDAAAKTTEPKRQGGMFVKINMYGVPIGRKVDLSAHNSYEQLSFTVDKLFRGLLAAQRDFPSSIEDEKPITGLLDGNGEYTLTYEDNEGDKMLVGDVPWQMFVSSVKRLRVIKTSEISSALTYGNGKQEKMRR
Sequence Length
267
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29,898 Da
NCBI Official Full Name
indole-3-acetic acid inducible 18
NCBI Official Symbol
IAA18
NCBI Official Synonym Symbols
indole-3-acetic acid inducible 18; T14L22.14; T14L22_14
NCBI Protein Information
indole-3-acetic acid inducible 18
UniProt Protein Name
Auxin-responsive protein IAA18
Protein Family
UniProt Gene Name
IAA18
Uniprot Description
Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression.
Research Articles on IAA18
Similar Products
Product Notes
The IAA18 iaa18 (Catalog #AAA1075670) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-267, Full length protein. The amino acid sequence is listed below: MEGYSRNGEI SPKLLDLMIP QERRNWFHDE KNSVFKTEEK KLELKLGPPG EEDDDESMIR HMKKEPKDKS ILSLAGKYFS PSSTKTTSHK RTAPGPVVGW PPVRSFRKNL ASGSSSKLGN DSTTSNGVTL KNQKCDAAAK TTEPKRQGGM FVKINMYGVP IGRKVDLSAH NSYEQLSFTV DKLFRGLLAA QRDFPSSIED EKPITGLLDG NGEYTLTYED NEGDKMLVGD VPWQMFVSSV KRLRVIKTSE ISSALTYGNG KQEKMRR. It is sometimes possible for the material contained within the vial of "Auxin-responsive protein IAA18 (IAA18), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
