Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Scn1b blocking peptide

Scn1b Peptide - N-terminal region

Reactivity
Rat, Human
Applications
Western Blot
Synonyms
Scn1b; Scn1b Peptide - N-terminal region; Scn1b blocking peptide
Ordering
For Research Use Only!
Reactivity
Rat, Human
Form/Format
Lyophilized powder
Sequence
TFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIF
Sequence Length
218
Applicable Applications for Scn1b blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Scn1b blocking peptide
This is a synthetic peptide designed for use in combination with anti-Scn1b Antibody, made

Target Description: Scn1b has voltage sensitive sodium channel activity when coexpressed with alpha subunits; Scn1b plays a role in initiation and propogation of the action potential.
Product Categories/Family for Scn1b blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
sodium channel subunit beta-1 isoform 1
NCBI Official Synonym Full Names
sodium voltage-gated channel beta subunit 1
NCBI Official Symbol
Scn1b
NCBI Protein Information
sodium channel subunit beta-1
UniProt Protein Name
Sodium channel subunit beta-1
Protein Family
UniProt Gene Name
Scn1b
UniProt Entry Name
SCN1B_RAT

NCBI Description

has voltage sensitive sodium channel activity when coexpressed with alpha subunits; plays a role in initiation and propogation of the action potential [RGD, Feb 2006]

Uniprot Description

SCN1B: Crucial in the assembly, expression, and functional modulation of the heterotrimeric complex of the sodium channel. The subunit beta-1 can modulate multiple alpha subunit isoforms from brain, skeletal muscle, and heart. Its association with neurofascin may target the sodium channels to the nodes of Ranvier of developing axons and retain these channels at the nodes in mature myelinated axons. Defects in SCN1B are the cause of generalized epilepsy with febrile seizures plus type 1 (GEFS+1). Generalized epilepsy with febrile seizures-plus refers to a rare autosomal dominant, familial condition with incomplete penetrance and large intrafamilial variability. Patients display febrile seizures persisting sometimes beyond the age of 6 years and/or a variety of afebrile seizure types. GEFS+ is a disease combining febrile seizures, generalized seizures often precipitated by fever at age 6 years or more, and partial seizures, with a variable degree of severity. Defects in SCN1B are the cause of Brugada syndrome type 5 (BRGDA5). A tachyarrhythmia characterized by right bundle branch block and ST segment elevation on an electrocardiogram (ECG). It can cause the ventricles to beat so fast that the blood is prevented from circulating efficiently in the body. When this situation occurs (called ventricular fibrillation), the individual will faint and may die in a few minutes if the heart is not reset. Belongs to the sodium channel auxiliary subunit SCN1B (TC 8.A.17) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Channel, sodium; Membrane protein, integral

Cellular Component: voltage-gated sodium channel complex; T-tubule; plasma membrane

Molecular Function: sodium channel inhibitor activity; protein binding; sodium channel regulator activity; voltage-gated sodium channel activity

Biological Process: axon guidance; membrane depolarization; corticospinal neuron axon guidance; action potential propagation; regulation of sodium ion transport; locomotion; response to pyrethroid; cardiac muscle contraction

Research Articles on Scn1b

Similar Products

Product Notes

The Scn1b scn1b (Catalog #AAA3227626) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Scn1b Peptide - N-terminal region reacts with Rat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Scn1b can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Scn1b scn1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TFRQKGTEEF VKILRYENEV LQLEEDERFE GRVVWNGSRG TKDLQDLSIF. It is sometimes possible for the material contained within the vial of "Scn1b, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.