Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Atat1 blocking peptide

Atat1 Peptide - middle region

Gene Names
Atat1; TAT; Mec17; RGD1303066; 3110080J08Rik
Reactivity
Rat, Human
Applications
Western Blot
Synonyms
Atat1; Atat1 Peptide - middle region; Atat1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Rat, Human
Form/Format
Lyophilized powder
Sequence
WPLNRAPRRATPPAHPPPRSSSLGNSPDRGPLRPFVPEQELLRSLRLCPP
Sequence Length
421
Applicable Applications for Atat1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Atat1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Atat1 Antibody, made

Target Description: Atat1 specifically acetylates 'Lys-40' in alpha-tubulin on the lumenal side of microtubules. Atat1 may affect microtubule stability and regulate microtubule dynamics and may be involved in neuron development.
Product Categories/Family for Atat1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
alpha-tubulin N-acetyltransferase 1
NCBI Official Synonym Full Names
alpha tubulin acetyltransferase 1
NCBI Official Symbol
Atat1
NCBI Official Synonym Symbols
TAT; Mec17; RGD1303066; 3110080J08Rik
NCBI Protein Information
alpha-tubulin N-acetyltransferase 1
UniProt Protein Name
Alpha-tubulin N-acetyltransferase 1
UniProt Gene Name
Atat1
UniProt Synonym Gene Names
Alpha-TAT; Alpha-TAT1; TAT

Uniprot Description

Specifically acetylates 'Lys-40' in alpha-tubulin on the lumenal side of microtubules. Promotes microtubule destabilization and accelerates microtubule dynamics; this activity may be independent of acetylation activity. Acetylates alpha-tubulin with a slow enzymatic rate, due to a catalytic site that is not optimized for acetyl transfer. Enters the microtubule through each end and diffuses quickly throughout the lumen of microtubules. Acetylates only long/old microtubules because of its slow acetylation rate since it does not have time to act on dynamically unstable microtubules before the enzyme is released. Required for normal sperm flagellar function. Promotes directional cell locomotion and chemotaxis, through AP2A2-dependent acetylation of alpha-tubulin at clathrin-coated pits that are concentrated at the leading edge of migrating cells. May facilitate primary cilium assembly.

Research Articles on Atat1

Similar Products

Product Notes

The Atat1 atat1 (Catalog #AAA3231447) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Atat1 Peptide - middle region reacts with Rat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Atat1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Atat1 atat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: WPLNRAPRRA TPPAHPPPRS SSLGNSPDRG PLRPFVPEQE LLRSLRLCPP. It is sometimes possible for the material contained within the vial of "Atat1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.