Vat1l blocking peptide
Vat1l Peptide - N-terminal region
Gene Names
Vat1l; AI427515; mKIAA1576; 9430073I07
Reactivity
Mouse, Human
Synonyms
Vat1l; Vat1l Peptide - N-terminal region; Vat1l blocking peptide
Reactivity
Mouse, Human
Form/Format
Lyophilized powder
Sequence
FIDLMVRQGNIDNPPKTPLVPGFECSGIVEALGDSVKGYEIGDRVMAFVN
Sequence Length
417
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Vat1l blocking peptide
This is a synthetic peptide designed for use in combination with anti-Vat1l Antibody, made
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for Vat1l blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
synaptic vesicle membrane protein VAT-1 homolog-like
NCBI Official Synonym Full Names
vesicle amine transport protein 1 like
NCBI Official Symbol
Vat1l
NCBI Official Synonym Symbols
AI427515; mKIAA1576; 9430073I07
NCBI Protein Information
synaptic vesicle membrane protein VAT-1 homolog-like
UniProt Protein Name
Synaptic vesicle membrane protein VAT-1 homolog-like
Protein Family
UniProt Gene Name
Vat1l
UniProt Synonym Gene Names
Kiaa1576
UniProt Entry Name
VAT1L_MOUSE
Similar Products
Product Notes
The Vat1l vat1l (Catalog #AAA3238328) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Vat1l Peptide - N-terminal region reacts with Mouse, Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: FIDLMVRQGN IDNPPKTPLV PGFECSGIVE ALGDSVKGYE IGDRVMAFVN. It is sometimes possible for the material contained within the vial of "Vat1l, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
