Sos1 blocking peptide

Sos1 Peptide - N-terminal region

Cat. Num. AAA3240874

• Gene Names: Sos1; AI449023; 9630010N06; 4430401P03Rik
• Reactivity: Mouse, Human
• Applications: Western Blot
• Synonyms: Sos1; Sos1 Peptide - N-terminal region; Sos1 blocking peptide

• Reactivity: Mouse, Human
• Form/Format: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: YFELLKQLEEKSEDQEDKECMKQAITALLNVQSGMEKICSKSLAKRRLSE
• Sequence Length: 1319

• Applicable Applications for Sos1 blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for Sos1 blocking peptide

This is a synthetic peptide designed for use in combination with anti-Sos1 Antibody, made

Target Description: Sos1 promotes the exchange of Ras-bound GDP by GTP.

Product Categories/Family for Sos1 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 117414170
• NCBI GeneID: 20662
• NCBI Accession #: NP_033257
• NCBI GenBank Nucleotide #: NM_009231
• UniProt Accession #: Q62245
• Molecular Weight: 151kDa
• NCBI Official Full Name: son of sevenless homolog 1
• NCBI Official Synonym Full Names: SOS Ras/Rac guanine nucleotide exchange factor 1
• NCBI Official Symbol: Sos1
• NCBI Official Synonym Symbols: AI449023; 9630010N06; 4430401P03Rik
• NCBI Protein Information: son of sevenless homolog 1
• UniProt Protein Name: Son of sevenless homolog 1
• Protein Family: Son of sevenless
• UniProt Gene Name: Sos1
• UniProt Synonym Gene Names: SOS-1; mSOS-1

Uniprot Description

SOS1: a guanine nucleotide exchange factor that activates Ras by catalyzing the exchange of bound GDP for GTP. Interacts with GRB2, NCK, and other adapter proteins. Plays an important role in signaling pathways leading from the G-protein- coupled receptors and receptor tyrosine kinases to MAPK/ERK.

Protein type: Adaptor/scaffold; GEF; GEF, Ras; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17 E3|17 50.67 cM

Cellular Component: cell soma; cytoplasm; plasma membrane; postsynaptic density

Molecular Function: DNA binding; guanyl-nucleotide exchange factor activity; protein binding; protein heterodimerization activity; Ras guanyl-nucleotide exchange factor activity; Rho guanyl-nucleotide exchange factor activity; SH3 domain binding

Biological Process: B cell homeostasis; blood vessel morphogenesis; cardiac atrium morphogenesis; epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; hair follicle development; heart morphogenesis; lymphocyte homeostasis; midbrain morphogenesis; multicellular organism growth; nerve growth factor receptor signaling pathway; palate development; pericardium morphogenesis; positive regulation of Ras protein signal transduction; positive regulation of small GTPase mediated signal transduction; Ras protein signal transduction; regulation of pro-B cell differentiation; regulation of Rho protein signal transduction; regulation of T cell differentiation in the thymus; regulation of T cell proliferation; small GTPase mediated signal transduction; vitellogenesis