Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Sos1 blocking peptide

Sos1 Peptide - N-terminal region

Gene Names
Sos1; AI449023; 9630010N06; 4430401P03Rik
Reactivity
Mouse, Human
Applications
Western Blot
Synonyms
Sos1; Sos1 Peptide - N-terminal region; Sos1 blocking peptide
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Reactivity
Mouse, Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: YFELLKQLEEKSEDQEDKECMKQAITALLNVQSGMEKICSKSLAKRRLSE
Sequence Length
1319
Applicable Applications for Sos1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Sos1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Sos1 Antibody, made

Target Description: Sos1 promotes the exchange of Ras-bound GDP by GTP.
Product Categories/Family for Sos1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
151kDa
NCBI Official Full Name
son of sevenless homolog 1
NCBI Official Synonym Full Names
SOS Ras/Rac guanine nucleotide exchange factor 1
NCBI Official Symbol
Sos1
NCBI Official Synonym Symbols
AI449023; 9630010N06; 4430401P03Rik
NCBI Protein Information
son of sevenless homolog 1
UniProt Protein Name
Son of sevenless homolog 1
Protein Family
UniProt Gene Name
Sos1
UniProt Synonym Gene Names
SOS-1; mSOS-1

Uniprot Description

SOS1: a guanine nucleotide exchange factor that activates Ras by catalyzing the exchange of bound GDP for GTP. Interacts with GRB2, NCK, and other adapter proteins. Plays an important role in signaling pathways leading from the G-protein- coupled receptors and receptor tyrosine kinases to MAPK/ERK.

Protein type: Adaptor/scaffold; GEF; GEF, Ras; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17 E3|17 50.67 cM

Cellular Component: cell soma; cytoplasm; plasma membrane; postsynaptic density

Molecular Function: DNA binding; guanyl-nucleotide exchange factor activity; protein binding; protein heterodimerization activity; Ras guanyl-nucleotide exchange factor activity; Rho guanyl-nucleotide exchange factor activity; SH3 domain binding

Biological Process: B cell homeostasis; blood vessel morphogenesis; cardiac atrium morphogenesis; epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; hair follicle development; heart morphogenesis; lymphocyte homeostasis; midbrain morphogenesis; multicellular organism growth; nerve growth factor receptor signaling pathway; palate development; pericardium morphogenesis; positive regulation of Ras protein signal transduction; positive regulation of small GTPase mediated signal transduction; Ras protein signal transduction; regulation of pro-B cell differentiation; regulation of Rho protein signal transduction; regulation of T cell differentiation in the thymus; regulation of T cell proliferation; small GTPase mediated signal transduction; vitellogenesis

Research Articles on Sos1

Similar Products

Product Notes

The Sos1 sos1 (Catalog #AAA3240874) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Sos1 Peptide - N-terminal region reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Sos1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Sos1 sos1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YFELLKQLEE KSEDQEDKEC MKQAITALLN VQSGMEKICS KSLAKRRLSE. It is sometimes possible for the material contained within the vial of "Sos1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual