Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rgs14 blocking peptide

Rgs14 Peptide - middle region

Gene Names
Rgs14; RPIP1
Reactivity
Mouse, Human
Applications
Western Blot
Synonyms
Rgs14; Rgs14 Peptide - middle region; Rgs14 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse, Human
Form/Format
Lyophilized powder
Sequence
LGSPDTARKKPKLKPGKSLPLGVEELGQLPLAEGPCGRPLRKSFRREMTG
Sequence Length
547
Applicable Applications for Rgs14 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Rgs14 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Rgs14 Antibody, made

Target Description: Rgs14 acts as a regulator of G protein signaling (RGS). It modulates G protein alpha subunits nucleotide exchange and hydrolysis activities by functioning either as a GTPase-activating protein (GAP), thereby driving G protein alpha subunits into their inactive GDP-bound form, or as a GDP-dissociation inhibitor (GDI).
Product Categories/Family for Rgs14 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
regulator of G-protein signaling 14 isoform 1
NCBI Official Synonym Full Names
regulator of G-protein signaling 14
NCBI Official Symbol
Rgs14
NCBI Official Synonym Symbols
RPIP1
NCBI Protein Information
regulator of G-protein signaling 14
UniProt Protein Name
Regulator of G-protein signaling 14
UniProt Gene Name
Rgs14
UniProt Synonym Gene Names
RGS14; RPIP1

Uniprot Description

Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Besides, modulates signal transduction via G protein alpha subunits by functioning as a GDP-dissociation inhibitor (GDI). Has GDI activity on G(i) alpha subunits GNAI1 and GNAI3, but not on GNAI2 and G(o) alpha subunit GNAO1. Has GAP activity on GNAI0, GNAI2 and GNAI3. May act as a scaffold integrating G protein and Ras/Raf MAPkinase signaling pathways. Inhibits platelet-derived growth factor (PDGF)-stimulated ERK1/ERK2 phosphorylation; a process depending on its interaction with HRAS and that is reversed by G(i) alpha subunit GNAI1. Acts as a positive modulator of microtubule polymerisation and spindle organization through a G(i)-alpha-dependent mechanism. Plays a role in cell division; required for completion of the first mitotic division of the embryo. Involved in visual memory processing capacity; when overexpressed in the V2 secondary visual cortex area. Involved in hippocampal-based learning and memory; acts as a suppressor of synaptic plasticity in CA2 neurons. Required for the nerve growth factor (NGF)-mediated neurite outgrowth. Involved in stress resistance.

Research Articles on Rgs14

Similar Products

Product Notes

The Rgs14 rgs14 (Catalog #AAA3226837) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Rgs14 Peptide - middle region reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Rgs14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Rgs14 rgs14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LGSPDTARKK PKLKPGKSLP LGVEELGQLP LAEGPCGRPL RKSFRREMTG. It is sometimes possible for the material contained within the vial of "Rgs14, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.