Prdm4 blocking peptide
Prdm4 Peptide - C-terminal region
Gene Names
Prdm4; SC1; SC-1; AW552272; 1700031E19Rik; 2810470D21Rik
Reactivity
Mouse, Human
Applications
Western Blot
Synonyms
Prdm4; Prdm4 Peptide - C-terminal region; Prdm4 blocking peptide
Reactivity
Mouse, Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: HLKTCKEPSSSSSAQEEEDDESEEEDLADSMRTEDCRMGSAVYSTDESLS
Sequence Length
803
Applicable Applications for Prdm4 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Prdm4 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Prdm4 Antibody, made
Target Description: Prdm4 may function as a transcription factor involved in cell differentiation.
Target Description: Prdm4 may function as a transcription factor involved in cell differentiation.
Product Categories/Family for Prdm4 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88kDa
NCBI Official Full Name
PR domain zinc finger protein 4 isoform 1
NCBI Official Synonym Full Names
PR domain containing 4
NCBI Official Symbol
Prdm4
NCBI Official Synonym Symbols
SC1; SC-1; AW552272; 1700031E19Rik; 2810470D21Rik
NCBI Protein Information
PR domain zinc finger protein 4
UniProt Protein Name
PR domain zinc finger protein 4
Protein Family
UniProt Gene Name
Prdm4
UniProt Entry Name
PRDM4_MOUSE
NCBI Description
This gene encodes a member of the PR/SET family of zinc finger proteins. This protein has been shown to bind DNA in a sequence-specific manner and has been implicated in neural stem cell proliferation and differentiation. Pseudogenes have been identified on chromosomes 14 and X. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014]
Research Articles on Prdm4
Similar Products
Product Notes
The Prdm4 prdm4 (Catalog #AAA3225526) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Prdm4 Peptide - C-terminal region reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Prdm4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Prdm4 prdm4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HLKTCKEPSS SSSAQEEEDD ESEEEDLADS MRTEDCRMGS AVYSTDESLS. It is sometimes possible for the material contained within the vial of "Prdm4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
