Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Oprm1 blocking peptide

Oprm1 Peptide - middle region

Gene Names
Oprm1; mor; Oprm; muOR; MOP-R; MOR-1; M-OR-1; MOR-1O
Reactivity
Mouse, Human
Applications
Western Blot
Synonyms
Oprm1; Oprm1 Peptide - middle region; Oprm1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse, Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: CYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
Sequence Length
444
Applicable Applications for Oprm1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 20 degree C. Avoid repeat freezethaw cycles.
Related Product Information for Oprm1 blocking peptide
This is a synthetic peptide designed for use in combination with antiOprm1 Antibody, made

Target Description: This gene encodes the mu opioid receptor which is where drugs such as morphine and other opioids have pharmacological effects. Alternatively spliced transcript variants have been found for this gene, however, many of these variants may be NMD candidates.
Product Categories/Family for Oprm1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
mu-type opioid receptor isoform MOR-1C
NCBI Official Synonym Full Names
opioid receptor, mu 1
NCBI Official Symbol
Oprm1
NCBI Official Synonym Symbols
mor; Oprm; muOR; MOP-R; MOR-1; M-OR-1; MOR-1O
NCBI Protein Information
mu-type opioid receptor
UniProt Protein Name
Mu-type opioid receptor
Protein Family
UniProt Gene Name
Oprm1
UniProt Synonym Gene Names
Mor; Oprm; M-OR-1; MOR-1
UniProt Entry Name
OPRM_MOUSE

NCBI Description

This gene encodes the mu opioid receptor which is where drugs such as morphine and other opioids have pharmacological effects. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014]

Uniprot Description

MOR-1: a Gi-protein-coupled receptor for beta-endorphin, morphine and other opiates. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Ligand-binding inactivates adenylyl cyclase, and activates a variety of G-beta-gamma-dependent pathways including the MAPK and the PI3K/Akt cascades. Two splice-variant isoforms have been described.

Protein type: GPCR, family 1; Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR

Cellular Component: dendrite cytoplasm; neuron projection; focal adhesion; integral to plasma membrane; dendrite; integral to membrane; perikaryon; cytosol; lipid raft; membrane; cytoplasm; plasma membrane; sarcolemma

Molecular Function: voltage-gated calcium channel activity; G-protein coupled receptor activity; protein domain specific binding; neuropeptide binding; signal transducer activity; protein binding; opioid receptor activity; G-protein alpha-subunit binding; G-protein beta-subunit binding; beta-endorphin receptor activity; filamin binding

Biological Process: positive regulation of neurogenesis; positive regulation of nitric oxide biosynthetic process; cellular response to stress; negative regulation of nitric oxide biosynthetic process; negative regulation of adenylate cyclase activity; locomotory behavior; behavioral response to ethanol; signal transduction; sensory perception of pain; synaptic transmission; G-protein coupled receptor protein signaling pathway; elevation of cytosolic calcium ion concentration; response to ethanol; neuropeptide signaling pathway; positive regulation of appetite; reduction of cytosolic calcium ion concentration; opioid receptor, adenylate cyclase inhibiting pathway; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); regulation of sensory perception of pain; G-protein signaling, adenylate cyclase inhibiting pathway; regulation of excitatory postsynaptic membrane potential; dopamine receptor, adenylate cyclase activating pathway

Research Articles on Oprm1

Similar Products

Product Notes

The Oprm1 oprm1 (Catalog #AAA3241317) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Oprm1 Peptide - middle region reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Oprm1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Oprm1 oprm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CYGLMILRLK SVRMLSGSKE KDRNLRRITR MVLVVVAVFI VCWTPIHIYV. It is sometimes possible for the material contained within the vial of "Oprm1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.