Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Dnajb1 blocking peptide

Dnajb1 Peptide - C-terminal region

Gene Names
Dnajb1; DjB1; Hdj1; HSPF1; Hsp40; 0610007I11Rik
Reactivity
Mouse, Human
Applications
Western Blot
Synonyms
Dnajb1; Dnajb1 Peptide - C-terminal region; Dnajb1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse, Human
Form/Format
Lyophilized powder
Sequence
VFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLVIEFEVIFPERIPVSSRTI
Sequence Length
340
Applicable Applications for Dnajb1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Dnajb1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Dnajb1 Antibody, made

Target Description: Dnajb1 interacts with HSP70 and can stimulate its ATPase activity. It stimulates the association between HSC70 and HIP.
Product Categories/Family for Dnajb1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
dnaJ homolog subfamily B member 1 isoform 1
NCBI Official Synonym Full Names
DnaJ heat shock protein family (Hsp40) member B1
NCBI Official Symbol
Dnajb1
NCBI Official Synonym Symbols
DjB1; Hdj1; HSPF1; Hsp40; 0610007I11Rik
NCBI Protein Information
dnaJ homolog subfamily B member 1
UniProt Protein Name
DnaJ homolog subfamily B member 1
Protein Family
UniProt Gene Name
Dnajb1
UniProt Synonym Gene Names
Hsp40; Hspf1; HSP40; Heat shock protein 40
UniProt Entry Name
DNJB1_MOUSE

NCBI Description

This gene encodes a member of the DnaJ or Hsp40 (heat shock protein 40 kD) family of proteins. The encoded protein is a molecular chaperone that stimulates the ATPase activity of Hsp70 heat-shock proteins in order to promote protein folding and prevent misfolded protein aggregation. The encoded protein may also inhibit apoptosis. Peritoneal macrophages derived from homozygous knockout mice for this gene exhibit impaired heat tolerance. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]

Uniprot Description

HSP40: a chaperone protein that translocates rapidly from the cytoplasm to the nucleus, and especially to the nucleoli, upon heat shock.Interacts with HSP70 and can stimulate its ATPase activity. Stimulates the association between HSC70 and HIP. Interacts with DNAJC3. Interacts with SRPK1.

Protein type: Chaperone; Nucleolus

Cellular Component: cytoplasm; cytosol; nucleus

Molecular Function: ATPase activator activity; ATPase binding; chaperone binding; Hsp70 protein binding; unfolded protein binding

Biological Process: chaperone cofactor-dependent protein folding; positive regulation of ATPase activity; protein folding

Research Articles on Dnajb1

Similar Products

Product Notes

The Dnajb1 dnajb1 (Catalog #AAA3236815) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Dnajb1 Peptide - C-terminal region reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Dnajb1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Dnajb1 dnajb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VFKDVIRPGM RRKVPGEGLP LPKTPEKRGD LVIEFEVIFP ERIPVSSRTI. It is sometimes possible for the material contained within the vial of "Dnajb1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.